NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS5628.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5628.1 Public Homo sapiens 7 CDK6 22 109 92 CCDS HistoryNCBI Gene:1021Re-query CCDS DB by CCDS ID:5628.1See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5628.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000265734.8 ENSP00000265734.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000265734.8Link to Ensembl Protein Viewer:ENSP00000265734.4Re-query CCDS DB by Nucleotide ID:ENST00000265734Re-query CCDS DB by Protein ID:ENSP00000265734
Original member Current member EBI,WTSI ENST00000424848.2 ENSP00000397087.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000424848.2Link to Ensembl Protein Viewer:ENSP00000397087.2Re-query CCDS DB by Nucleotide ID:ENST00000424848Re-query CCDS DB by Protein ID:ENSP00000397087
Original member Current member NCBI NM_001145306.1 NP_001138778.1 Accepted alive Link to Nucleotide Sequence:NM_001145306.1Link to Protein Sequence:NP_001138778.1Re-query CCDS DB by Nucleotide ID:NM_001145306Re-query CCDS DB by Protein ID:NP_001138778Link to BLAST:NP_001138778.1
Original member NCBI NM_001259.7 NP_001250.1 Updated not alive Link to Nucleotide Sequence:NM_001259.7Link to Protein Sequence:NP_001250.1Re-query CCDS DB by Nucleotide ID:NM_001259Re-query CCDS DB by Protein ID:NP_001250
Current member NCBI NM_001259.8 NP_001250.1 Accepted alive Link to Nucleotide Sequence:NM_001259.8Link to Protein Sequence:NP_001250.1Re-query CCDS DB by Nucleotide ID:NM_001259Re-query CCDS DB by Protein ID:NP_001250Link to BLAST:NP_001250.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001138778.1 326 Q00534 326 100% 0 0
NP_001250.1 326 Q00534 326 100% 0 0

Chromosomal Locations for CCDS 5628.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 92615140 92615286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 92618072 92618207 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 92623036 92623086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 92671426 92671535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 92725626 92725793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 92774696 92774831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 92833091 92833323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (981 nt):
ATGGAGAAGGACGGCCTGTGCCGCGCTGACCAGCAGTACGAATGCGTGGCGGAGATCGGGGAGGGCGCCT
AT
GGGAAGGTGTTCAAGGCCCGCGACTTGAAGAACGGAGGCCGTTTCGTGGCGTTGAAGCGCGTGCGGGT
G
CAGACCGGCGAGGAGGGCATGCCGCTCTCCACCATCCGCGAGGTGGCGGTGCTGAGGCACCTGGAGACC
TTC
GAGCACCCCAACGTGGTCAGGTTGTTTGATGTGTGCACAGTGTCACGAACAGACAGAGAAACCAAAC
TA
ACTTTAGTGTTTGAACATGTCGATCAAGACTTGACCACTTACTTGGATAAAGTTCCAGAGCCTGGAGT
G
CCCACTGAAACCATAAAGGATATGATGTTTCAGCTTCTCCGAGGTCTGGACTTTCTTCATTCACACCGA
GTA
GTGCATCGCGATCTAAAACCACAGAACATTCTGGTGACCAGCAGCGGACAAATAAAACTCGCTGACT
TC
GGCCTTGCCCGCATCTATAGTTTCCAGATGGCTCTAACCTCAGTGGTCGTCACGCTGTGGTACAGAGC
A
CCCGAAGTCTTGCTCCAGTCCAGCTACGCCACCCCCGTGGATCTCTGGAGTGTTGGCTGCATATTTGCA
GAA
ATGTTTCGTAGAAAGCCTCTTTTTCGTGGAAGTTCAGATGTTGATCAACTAGGAAAAATCTTGGACG
TG
ATTGGACTCCCAGGAGAAGAAGACTGGCCTAGAGATGTTGCCCTTCCCAGGCAGGCTTTTCATTCAAA
A
TCTGCCCAACCAATTGAGAAGTTTGTAACAGATATCGATGAACTAGGCAAAGACCTACTTCTGAAGTGT
TTG
ACATTTAACCCAGCCAAAAGAATATCTGCCTACAGTGCCCTGTCTCACCCATACTTCCAGGACCTGG
AA
AGGTGCAAAGAAAACCTGGATTCCCACCTGCCGCCCAGCCAGAACACCTCGGAGCTGAATACAGCCTG
A


Translation (326 aa):
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLET
F
EHPNVV
RLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHR
V
VHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSV
VVTLWYRAPEVLLQSSYATPVDLWSVGCIFA
E
MFRR
KPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKC
L
TFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser