NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9182.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9182.1 Public Homo sapiens 12 FBXW8 22 109 92 CCDS HistoryNCBI Gene:26259Re-query CCDS DB by CCDS ID:9182.1Re-query CCDS DB by GeneID:26259See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9182.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000309909.9 ENSP00000310686.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000309909.9Link to Ensembl Protein Viewer:ENSP00000310686.5Re-query CCDS DB by Nucleotide ID:ENST00000309909Re-query CCDS DB by Protein ID:ENSP00000310686
Original member NCBI NM_153348.2 NP_699179.2 Updated not alive Link to Nucleotide Sequence:NM_153348.2Link to Protein Sequence:NP_699179.2Re-query CCDS DB by Nucleotide ID:NM_153348Re-query CCDS DB by Protein ID:NP_699179
Current member NCBI NM_153348.3 NP_699179.2 Accepted alive Link to Nucleotide Sequence:NM_153348.3Link to Protein Sequence:NP_699179.2Re-query CCDS DB by Nucleotide ID:NM_153348Re-query CCDS DB by Protein ID:NP_699179Link to BLAST:NP_699179.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_699179.2 598 Q8N3Y1-1 598 100% 0 0

Chromosomal Locations for CCDS 9182.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 116911038 116911355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 116928023 116928127 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 116945364 116945528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 116949618 116949706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 116964697 116964854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 116985206 116985402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 116988663 116988869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 117010323 117010450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 117024147 117024320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 117027394 117027504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 117028028 117028172 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1797 nt):
ATGGACGACTACAGCCTGGATGAGTTCCGTCGGCGCTGGCAGGAGGAGCTGGCGCAGGCCCAGGCGCCGA
AG
AAGCGGCGACGGCCCGAGGCTGCCGAGAGGCGGGCTCGGCGGCCGGAGGTGGGCTCCGGGCGCGGCGA
A
CAGGCCTCGGGGGACCCGGCGCTGGCCCAGCGTCTCCTGGAGGGCGCGGGGAGGCCCCCGGCGGCGCGG
GCG
ACTCGGGCCGAGGGGCAGGACGTAGCGAGCCGCTCACGTTCTCCTCTGGCCCGCGAGGGCGCCGGGG
GC
GGGGAGCAGCTGGTGGACCAGCTCATCCGCGACCTGAATGAAATGAATGATGTGCCTTTCTTTGATAT
C
CAACTGCCTTACGAATTGGCAATCAATATATTTCAGTATCTGGACAGGAAAGAACTAGGAAGATGTGCA
CAG
GTGAGCAAGACGTGGAAGGTGATTGCAGAGGATGAGGTGCTGTGGTACAGGCTGTGCCAGCAGGAAG
GG
CACCTTCCGGATAGCAGCATCTCTGACTATTCTTGCTGGAAGCTCATCTTCCAAGAGTGCCGAGCCAA
G
GAACACATGTTACGAACCAACTGGAAGAATCGCAAAGGTGCCGTGAGCGAGCTGGAGCATGTTCCTGAC
ACA
GTTTTGTGTGATGTGCATTCTCACGATGGTGTGGTCATTGCGGGATATACATCAGGGGATGTGAGAG
TG
TGGGACACCCGCACCTGGGACTACGTAGCCCCCTTCCTGGAATCAGAGGACGAGGAGGATGAGCCTGG
A
ATGCAGCCAAATGTCTCCTTTGTGAGGATAAACAGCTCGTTGGCAGTAGCAGCTTATGAGGATGGGTTT
CTT
AATATTTGGGATTTAAGGACCGGAAAGTACCCTGTTCATCGTTTTGAGCACGATGCAAGAATACAGG
CA
CTAGCCCTCAGCCAGGACGATGCAACCGTGGCCACAGCTTCTGCTTTTGATGTCGTGATGTTATCCCC
C
AATGAGGAGGGGTACTGGCAGATAGCTGCGGAATTTGAAGTTCCGAAACTGGTTCAGTACCTTGAAATA
GTT
CCAGAAACCAGAAGGTACCCTGTGGCAGTAGCCGCTGCTGGAGATCTGATGTACCTGCTCAAAGCCG
AA
GACTCCGCCAGAACCCTCCTTTACGCCCACGGCCCGCCTGTCACATGTCTAGACGTCTCGGCCAACCA
A
GTTGCTTTTGGTGTACAGGGTCTGGGATGGGTGTACGAAGGAAGCAAGATCCTGGTGTATAGCCTGGAA
GCA
GGACGCCGCCTCTTGAAGCTGGGTAACGTTCTCCGTGACTTCACGTGTGTCAACCTCAGCGACAGCC
CT
CCCAACCTCATGGTCAGTGGCAACATGGACGGGAGGGTGAGGATCCACGACCTCCGCAGTGGTAACAT
C
GCCCTGTCGCTCTCCGCCCATCAGCTCAGGGTCTCTGCTGTGCAGATGGATGACTGGAAGATCGTCAGT
GGA
GGCGAGGAAGGCCTGGTGTCCGTGTGGGATTATCGGATGAACCAGAAGCTGTGGGAGGTGTATTCCG
G
G
CACCCGGTGCAGCACATCTCATTCAGCAGCCACAGCCTCATCACGGCCAACGTGCCTTACCAGACGGT
A
ATGCGAAACGCCGACCTGGACAGCTTCACTACTCACAGGAGACACCGGGGGCTGATCCGCGCCTATGAG
TTT
GCGGTGGACCAGCTGGCCTTCCAGAGCCCTCTCCCTGTCTGCCGTTCATCCTGTGACGCCATGGCCA
CT
CACTACTACGACCTCGCACTGGCCTTTCCCTATAACCATGTTTAG


Translation (598 aa):
MDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQRLLEGAGRPPAAR
A
TRAEGQDVASRSRSPLAREGAGGGEQLVDQLIRDL
NEMNDVPFFDIQLPYELAINIFQYLDRKELGRCA
Q
VSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLIFQECRAKEHMLRTNWKNRKGAVSELEHVPD
T
VLCDVHSHDGVVIA
GYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGF
L
NIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKL
VQYLEI
V
PETRRYPVAVAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSK
ILVYSLE
A
GRRLLKLGNVLRDFTCVNLSDSPPNLMVSGNMDG
RVRIHDLRSGNIALSLSAHQLRVSAVQMDDWKIVS
G
GEEGLVSVWDYRMNQKLWEVYS
GHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYE
F
AVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser