NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8902.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8902.1 Public Homo sapiens 12 PA2G4 22 109 92 CCDS HistoryNCBI Gene:5036Re-query CCDS DB by CCDS ID:8902.1Re-query CCDS DB by GeneID:5036See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8902.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000303305.10 ENSP00000302886.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000303305.10Link to Ensembl Protein Viewer:ENSP00000302886.6Re-query CCDS DB by Nucleotide ID:ENST00000303305Re-query CCDS DB by Protein ID:ENSP00000302886
Original member NCBI NM_006191.2 NP_006182.2 Updated not alive Link to Nucleotide Sequence:NM_006191.2Link to Protein Sequence:NP_006182.2Re-query CCDS DB by Nucleotide ID:NM_006191Re-query CCDS DB by Protein ID:NP_006182
Current member NCBI NM_006191.3 NP_006182.2 Accepted alive Link to Nucleotide Sequence:NM_006191.3Link to Protein Sequence:NP_006182.2Re-query CCDS DB by Nucleotide ID:NM_006191Re-query CCDS DB by Protein ID:NP_006182Link to BLAST:NP_006182.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006182.2 394 Q9UQ80-1 394 100% 0 0

Chromosomal Locations for CCDS 8902.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 56104738 56104825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56106588 56106716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56106990 56107095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56107187 56107256 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56107521 56107613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56109230 56109293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56109857 56109935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56110399 56110477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56110559 56110692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56110964 56111058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56111182 56111309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56111476 56111529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 56112823 56112888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1185 nt):
ATGTCGGGCGAGGACGAGCAACAGGAGCAAACTATCGCTGAGGACCTGGTCGTGACCAAGTATAAGATGG
GG
GGCGACATCGCCAACAGGGTACTTCGGTCCTTGGTGGAAGCATCTAGCTCAGGTGTGTCGGTACTGAG
C
CTGTGTGAGAAAGGTGATGCCATGATTATGGAAGAAACAGGGAAAATCTTCAAGAAAGAAAAGGAAATG
AAG
AAAGGTATTGCTTTTCCCACCAGCATTTCGGTAAATAACTGTGTATGTCACTTCTCCCCTTTGAAGA
GC
GACCAGGATTATATTCTCAAGGAAGGTGACTTGGTAAAAATTGACCTTGGGGTCCATGTGGATGGCTT
C
ATCGCTAATGTAGCTCACACTTTTGTGGTTGATGTAGCTCAGGGGACCCAAGTAACAGGGAGGAAAGCA
GAT
GTTATTAAGGCAGCTCACCTTTGTGCTGAAGCTGCCCTACGCCTGGTCAAACCTGGAAATCAGAACA
CA
CAAGTGACAGAAGCCTGGAACAAAGTTGCCCACTCATTTAACTGCACGCCAATAGAAGGTATGCTGTC
A
CACCAGTTGAAGCAGCATGTCATCGATGGAGAAAAAACCATTATCCAGAATCCCACAGACCAGCAGAAG
AAG
GACCATGAAAAAGCTGAATTTGAGGTACATGAAGTATATGCTGTGGATGTTCTCGTCAGCTCAGGAG
AG
GGCAAGGCCAAGGATGCAGGACAGAGAACCACTATTTACAAACGAGACCCCTCTAAACAGTATGGACT
G
AAAATGAAAACTTCACGTGCCTTCTTCAGTGAGGTGGAAAGGCGTTTTGATGCCATGCCGTTTACTTTA
AG
A
GCATTTGAAGATGAGAAGAAGGCTCGGATGGGTGTGGTGGAGTGCGCCAAACATGAACTGCTGCAAC
CA
TTTAATGTTCTCTATGAGAAGGAGGGTGAATTTGTTGCCCAGTTTAAATTTACAGTTCTGCTCATGCC
C
AATGGCCCCATGCGGATAACCAGTGGTCCCTTCGAGCCTGACCTCTACAAGTCTGAGATGGAGGTCCAG
GAT
GCAGAGCTAAAGGCCCTCCTCCAGAGTTCTGCAAGTCGAAAAACCCAGAAAAAGAAAAAAAAGAAGG
CC
TCCAAGACTGCAGAGAATGCCACCAGTGGGGAAACATTAGAAGAAAATGAAGCTGGGGACTGA


Translation (394 aa):
MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEM
K
K
GIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKA
D
VIKAAHLCAEAALRLVKPGNQ
NTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQK
K
DHEKAEFEVHEVYAVDVLVSSGEGK
AKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTL
R
AFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ
D
AELK
ALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser