NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS86887.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
86887.1 Public Homo sapiens 2 NR4A2 22 109 92 CCDS HistoryNCBI Gene:4929Re-query CCDS DB by CCDS ID:86887.1Re-query CCDS DB by GeneID:4929See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 22, NCBI annotation release 109, Ensembl annotation release 92

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 86887.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000426264.5 ENSP00000389986.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000426264.5Link to Ensembl Protein Viewer:ENSP00000389986.1Re-query CCDS DB by Nucleotide ID:ENST00000426264Re-query CCDS DB by Protein ID:ENSP00000389986
Current member NCBI NM_173173.2 NP_775265.1 Accepted alive Link to Nucleotide Sequence:NM_173173.2Link to Protein Sequence:NP_775265.1Re-query CCDS DB by Nucleotide ID:NM_173173Re-query CCDS DB by Protein ID:NP_775265Link to BLAST:NP_775265.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_775265.1 535 P43354-2 535 100% 0 0

Chromosomal Locations for CCDS 86887.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 156325744 156326000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 156326150 156326328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 156326718 156326920 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 156327851 156328014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 156328404 156328533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 156329323 156329997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1608 nt):
ATGGACAACTACAGCACAGGCTACGACGTCAAGCCACCTTGCTTGTACCAAATGCCCCTGTCCGGACAGC
AG
TCCTCCATTAAGGTAGAAGACATTCAGATGCACAACTACCAGCAACACAGCCACCTGCCCCCCCAGTC
T
GAGGAGATGATGCCGCACTCCGGGTCGGTTTACTACAAGCCCTCCTCGCCCCCGACGCCCACCACCCCG
GGC
TTCCAGGTGCAGCACAGCCCCATGTGGGACGACCCGGGATCTCTCCACAACTTCCACCAGAACTACG
TG
GCCACTACGCACATGATCGAGCAGAGGAAAACGCCAGTCTCCCGCCTCTCCCTCTTCTCCTTTAAGCA
A
TCGCCCCCTGGCACCCCGGTGTCTAGTTGCCAGATGCGCTTCGACGGGCCCCTGCACGTCCCCATGAAC
CCG
GAGCCCGCCGGCAGCCACCACGTGGTGGACGGGCAGACCTTCGCTGTGCCCAACCCCATTCGCAAGC
CC
GCGTCCATGGGCTTCCCGGGCCTGCAGATCGGCCACGCGTCTCAGCTGCTCGACACGCAGGTGCCCTC
A
CCGCCGTCGCGGGGCTCCCCCTCCAACGAGGGGCTGTGCGCTGTGTGTGGGGACAACGCGGCCTGCCAA
CAC
TACGGCGTGCGCACCTGTGAGGGCTGCAAAGGCTTCTTTAAGCGCACAGTGCAAAAAAATGCAAAAT
AC
GTGTGTTTAGCAAATAAAAACTGCCCAGTGGACAAGCGTCGCCGGAATCGCTGTCAGTACTGCCGATT
T
CAGAAGTGCCTGGCTGTTGGGATGGTCAAAGAAGTGGTTCGCACAGACAGTTTAAAAGGCCGGAGAGGT
CGT
TTGCCCTCGAAACCGAAGAGCCCACAGGAGCCCTCTCCCCCTTCGCCCCCGGTGAGTCTGATCAGTG
CC
CTCGTCAGGGCCCATGTCGACTCCAACCCGGCTATGACCAGCCTGGACTATTCCAGGTTCCAGGCGAA
C
CCTGACTATCAAATGAGTGGAGATGACACCCAGCATATCCAGCAATTCTATGATCTCCTGACTGGCTCC
ATG
GAGATCATCCGGGGCTGGGCAGAGAAGATCCCTGGCTTCGCAGACCTGCCCAAAGCCGACCAAGACC
TG
CTTTTTGAATCAGCTTTCTTAGAACTGTTTGTCCTTCGATTAGCATACAGGTCCAACCCAGTGGAGGG
T
AAACTCATCTTTTGCAATGGGGTGGTCTTGCACAGGTTGCAATGCGTTCGTGGCTTTGGGGAATGGATT
GAT
TCCATTGTTGAATTCTCCTCCAACTTGCAGAATATGAACATCGACATTTCTGCCTTCTCCTGCATTG
CT
GCCCTGGCTATGGTCACAGAGAGACACGGGCTCAAGGAACCCAAGAGAGTGGAAGAACTGCAAAACAA
G
ATTGTAAATTGTCTCAAAGACCACGTGACTTTCAACAATGGGGGGTTGAACCGCCCCAATTATTTGTCC
AAA
CTGTTGGGGAAGCTCCCAGAACTTCGTACCCTTTGCACACAGGGGCTACAGCGCATTTTCTACCTGA
AA
TTGGAAGACTTGGTGCCACCGCCAGCAATAATTGACAAACTTTTCCTGGACACTTTACCTTTCTAA


Translation (535 aa):
MDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTP
G
FQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMN
P
EPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQ
H
YGVRTCEGCKGFFK
RTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRG
R
LPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSR
FQANPDYQMSGDDTQHIQQFYDLLTGS
M
EIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAY
RSNPVEGKLIFCNGVVLHRLQCVRGFGEWI
D
SIVEFSSNLQNMNIDISAFSCIAALAMVT
ERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLS
K
LLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser