NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS72270.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
72270.1 Public Mus musculus 9 Aqp9 21 106 86 CCDS HistoryNCBI Gene:64008Re-query CCDS DB by CCDS ID:72270.1Re-query CCDS DB by GeneID:64008See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 72270.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000060917 ENSMUSP00000050127 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060917Link to Ensembl Protein Viewer:ENSMUSP00000050127Re-query CCDS DB by Nucleotide ID:ENSMUST00000060917Re-query CCDS DB by Protein ID:ENSMUSP00000050127
Original member Current member EBI,WTSI OTTMUST00000058379 OTTMUSP00000028277 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000058379Link to Vega Protein Viewer:OTTMUSP00000028277Re-query CCDS DB by Nucleotide ID:OTTMUST00000058379Re-query CCDS DB by Protein ID:OTTMUSP00000028277
Original member Current member NCBI NM_001271843.1 NP_001258772.1 Accepted alive Link to Nucleotide Sequence:NM_001271843.1Link to Protein Sequence:NP_001258772.1Re-query CCDS DB by Nucleotide ID:NM_001271843Re-query CCDS DB by Protein ID:NP_001258772Link to BLAST:NP_001258772.1

Chromosomal Locations for CCDS 72270.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 71112211 71112385 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 71122791 71123008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 71130421 71130539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 71132623 71132760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 71138088 71138214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 71162317 71162505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (966 nt):
ATGGCCTGGCAGTTTTATTTATTTGTTTGTTTGTTTGTTTATTTATTTATTTATGTGTGTGCACCAATGC
AC
ACAAGTGCATCTGAAAATGGCCTGCTGGAGTCAGCTCTCCTTCCACCATCCTTCCACCATGTGGACTC
T
AGGGATGGAGCTCAGGTCATCAGGCCCGGCAACAGGGACTTTTATCTCGTCCTTGGATGTGGCTCTATT
GCT
CAAGCAGTCCTCAGTCGAGAAAAGGCTGGTGGGATCATCACTATCAATATTGGATTTGCAACGGCAG
TT
GTGATGGCTCTTTATGCGACTTTTGGTGTCTCTGGGGGCCACATCAACCCAGCGGTGTCTTTTGCAAT
G
TGCACCTTTGGAAGGATGGAGTGGTTCAAGTTCCCCTTTTATGTGGGAGCTCAGCTTTTGGGAGCCTTT
GTC
GGGGCTGCAACTGTCTTTGGCATTTACTATGACGGACTCATGGCCTTTGCTGATGGAAAGCTGCTCA
TC
ACGGGAGAAAATGGAACGGCGTTCATTTTCGCGACATACCCAAAACCATTTGTATCCGTGCCAGGTGC
C
TTTGTAGACCAAGTGGTGTCTACCATGTTCCTCCTTCTGATTGTCTTTGCCATCTTTGACTCCAGAAAC
CTG
GGGGTCCCCAGAGGCCTGGAGCCCATTGTCATTGGCCTCCTAATCATTGTCATTTCCTGTTCTCTCG
GA
CTCAACTCTGGTTGTGCCATGAACCCTGCTCGAGACCTCAGCCCCAGGCTCTTCACTGCTCTGGCAGG
A
TGGGGATTTGAGGTCTTCACATTTGGAAATAACTTCTGGTGGATACCTGTCGTGGGCCCTATGATTGGA
GCT
GTCCTGGGAGGTCTCATCTATGTTCTTTTTATCCAAATGCATCACTCGAACCCCGACCCAGAAGTGA
AG
GCAGAACCAGCCGAGAACAATCTAGAAAAACACGAACTCAGCGTCATCATGTAG


Translation (321 aa):
MAWQFYLFVCLFVYLFIYVCAPMHTSASENGLLESALLPPSFHHVDSRDGAQVIRPGNRDFYLVLGCGSI
A
QAVLSREKAGGIITINIGFATAVVMALYATFGVS
GGHINPAVSFAMCTFGRMEWFKFPFYVGAQLLGAF
V
GAATVFGIYY
DGLMAFADGKLLITGENGTAFIFATYPKPFVSVPGAFVDQVVSTMFLLLIVFAIFDSRN
L
GVPRGLEPIVIGLLIIVISCSLGLNSGCAMNPARDLSPRLFTALAGWGFEVF
TFGNNFWWIPVVGPMIG
A
VLGGLIYVLFIQMHHSNPDPEVKAEPAENNLEKHELSVIM




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser