NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS70879.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
70879.1 Public Mus musculus 18 Brd8 21 106 86 CCDS HistoryNCBI Gene:78656Re-query CCDS DB by CCDS ID:70879.1Re-query CCDS DB by GeneID:78656See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 70879.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000097626 ENSMUSP00000095229 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000097626Link to Ensembl Protein Viewer:ENSMUSP00000095229Re-query CCDS DB by Nucleotide ID:ENSMUST00000097626Re-query CCDS DB by Protein ID:ENSMUSP00000095229
Original member Current member EBI,WTSI OTTMUST00000041845 OTTMUSP00000018817 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000041845Link to Vega Protein Viewer:OTTMUSP00000018817Re-query CCDS DB by Nucleotide ID:OTTMUST00000041845Re-query CCDS DB by Protein ID:OTTMUSP00000018817
Original member Current member NCBI NM_001289606.1 NP_001276535.1 Accepted alive Link to Nucleotide Sequence:NM_001289606.1Link to Protein Sequence:NP_001276535.1Re-query CCDS DB by Nucleotide ID:NM_001289606Re-query CCDS DB by Protein ID:NP_001276535Link to BLAST:NP_001276535.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001276535.1 878 Q8R3B7-2 878 100% 0 0

Chromosomal Locations for CCDS 70879.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 34600182 34600241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34602203 34602247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34602672 34602776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34603707 34603884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34604598 34604666 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34604831 34604923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34605474 34605688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34606420 34606466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34606675 34606768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34607039 34607491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34607775 34608055 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34608418 34608627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34609805 34609949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34611132 34611268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34613037 34613101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34613216 34613296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34614448 34614570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34614748 34614797 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34616665 34616734 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34623455 34623551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 34624538 34624556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2637 nt):
ATGGCGACCGGGACAGGCAAGCACAAGCTGCTGAGTACTGGCCCAACAGAGCCATGGTCCATCCGAGAGA
AG
TTGTGTTTAGCATCTTCTGTCATGAGGAGTGGGGATCAGAACTGGGTATCAGTTAGCAGAGCAATCAA
G
CCCTTTGCAGAACCTGGCCGGCCTCCAGACTGGTTCTCTCAAAAACATTGTGCTTCTCAGTATTCTGAG
CTC
TTAGAGACTACTGAGACTCCAAAACGGAAACGGGGTGAAAAAGGAGAAGTGGTAGAAACTGTTGAAG
AT
GTTATTGTTCGCAAACTGACTGCTGAGAGAGTTGAAGAACTGAAGAAAGTCATAAAGGAGACACAGGA
G
AGATACAGGCGTCTGAAAAGAGATGCAGAACTAATCCAAGCCGGGCACATGGACAGCAGACTGGATGAG
CTC
TGCAATGACATTGCAATGAAAAAGAAATTGGAAGAGGAAGAGGCTGAAGTAAAAAGGAAGGCCACCG
AT
GCTGCGTACCAGGCGCGACAAGCAGTGAAAACGCCTCCTCGAAGGTTACCGACTGTGATGGTCCGCTC
T
CCTGTAGACTCTGCCTCCCCAGGAGGTGATTACCCACTTGGAGACTTGACTCCAACCACTATGGAAGAG
GCT
ACCTCTGGGGTGAATGAGAGTGAAATGCCTGTACCCCCTGGCCATCTGAACAGCACAGGGGTTCTCT
TG
GAGGTAGGAGGGGTTCTTCCCATGATACATGGTGGGGAGATACAGCCAACAACCAGTGCTGTGGCGGC
C
TCCCCGGCTGCCTCAGGTGCTCCCACTCTTTCCCGGCTTTTAGAAGCTGGGCCCACACAGTTCACCACT
CCT
CTTCCTTCCTTCACTACTGTTGCCAGTGAGCCGCCAGTTAAGCTTGTGCCACCCCCTGTAGAGTCTG
TG
TCCCAGGCTACCATTGTCATGATGCCCGCGCTGCCAGCACCATCCTCTGCTGCGGCTGTCTCCACTTC
T
GAAAGTGGAGCTCCAGTGAGCCAGCCTGAGCCCTGTGTACCCCTGGAAGCTGTGGGGGATCCACATACT
GTG
ACTGTTTCCATGGATAGCAATGAAATCTCCATGATCATTAATTCCATCAAAGAAGAGTGTTTCCGCT
CA
GGGGTAGCAGAGGCTCCTGGTGGATCAAAGGCTCCAAGCATAGATGGGAAGGAAGACTTGGATCTAGC
G
GAGAAGATGGATATTGCTGTGTCTTACACAGGTGAAGAGTTGGACTTTGAAACAGTTGGAGACATCATT
GCC
ATCATTGAGGACAAGGTGGATGATCACCCTGAAGTGCTGGATGTGGCAGCGGTAGAAGCGGCGTTAT
CG
TTCTGTGAAGAGAATGATGACCCTCAGTCCCTGCCTGGCCCCTGGGAGCACCCTATCCAGCAGGAGCG
C
GACAAGCCAGTACCTCTGCCAGCACCAGAGATGACAGTCAAACAAGAGAGGCTAGACTTCGAGGAATCA
GAA
AACAAAGGGCTCCATGACCTGGTGGACATCAGGGATTCCGGTGTTGAGATTAAGGTGGAACCCACAG
AG
CCAGAGCCAGGCATGTCTGGGGCTGAGATAGTAGCTGGAGTTGGTCCAGTTCCAAGTATGGAGCCACC
A
GAACTCAGGAGTCAAGACTCAGATGAAGAACCTAGAAGTTCTGCAGCTGGAGACATTGGTGAGGCAGAT
GGT
TCCAGTGGGAAAGGCGATGAGAGGCCACTTTCAGCTGTGAAGACAGAGGCATCCCCTGAGAGCATGT
TG
TCTCCATCACATGGCTCAAATCTTATTGAAGATCCTTTAGAGGCAGAGACTCAACACAAGTTTGAAAT
G
TCAGACTCATTGAAAGAAGAATCAGGGACTATTTTTGGAAGCCAGATAAAGGATGCCCCAGGTGACGAT
GAG
GAAGAAGATGGAGTCAGTGAAGCAGCTAGCCTAGAGGAGCCTAAGGAAGAGGATCAAGGAGAAGGCT
AT
TTGTCTGAGATGGATAATGAGCCCCCTGTGAGTGAGAGTGATGATGGCTTTAGTATACATAACGCCAC
A
CTGCAGTCACACACTCTGGCAGACTCCATCCCAAGCAGCCCTGCCTCCTCCCAGTTTTCCGTGTGCAGT
GAA
GATCAAGAAGCAATTCAGGCTCAGAAAATATGGAAGAAAGCCATCATGCTTGTATGGAGGGCTGCAG
CA
AATCATAGGTATGCCAATGTGTTCCTGCAACCTGTTACAGATGACATAGCTCCTGGTTACCATAGCAT
T
GTACAGAGGCCTATGGATTTGTCAACTATAAAGAAAAACATTGAAAATGGACTGATCCGAAGCACAGCT
GAG
TTTCAGCGTGACATCATGCTGATGTTTCAGAATGCTGTTATGTACAATAGCTCAGACCATGATGTCT
AT
CACATGGCAGTAGAGATGCAGAGAGATGTCTTGGAACAGATCCAGCAATTCTTGGCCACACAGTTGAT
T
ATGCAAACATCTGAGTCTGGAATCAGTGCTAAAAGTCTCCGGGGGAGAGACTCTACCCGAAAACAAGAT
GCT
TCAGAGAAGGACAGTGTCCCCATGGGCTCTCCTGCCTTCCTTCTCTCTCTCTTTGATGGGGGAACCA
GG
GGACGCCGCTGTGCCATTGAAGCAGATATGAAGATGAAGAAGTGA


Translation (878 aa):
MATGTGKHKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRAIKPFAEPGRPPDWFSQKHCASQYSE
L
LETTETP
KRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQERYRRLKRDAELIQAGHMDSRLDE
L
CNDIA
MKKKLEEEEAEVKRKATDAAYQARQAVKTPPRRLPTVMVRSPVDSASPGGDYPLGDLTPTTMEE
A
TSG
VNESEMPVPPGHLNSTGVLLEVGGVLPMIHGGEIQPTTSAVAASPAASGAPTLSRLLEAGPTQFTT
P
LPSFTTVASEPPVKLVPPPVESVSQATIVMMPALPAPSSAAAVSTSESGAP
VSQPEPCVPLEAVGDPHT
V
TVSMDSNEISMIINSIKEECFRSGVAEAPGGSKAPSIDGKEDLDLAEKMDIAVSYTGEELDFETVGDII
A
IIEDK
VDDHPEVLDVAAVEAALSFCEENDDPQSLPGPWEHPIQQERDKPVPLPAPEMTVKQERLDFEES
E
NKGLHDLVDIRDSGVEIKVEPTEPEPGMSGAEIVAGVGPVPSMEPPELRSQDSDEEPRSSAAGDIGEAD
G
SSGKGDERPLSAVKTE
ASPESMLSPSHGSNLIEDPLEAETQHKFEMSDSLKEESGTIFGSQIKDAPGDD
E
EEDGVSEAASLEEPKEEDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSHTLADSIPSSPASSQ
FSVCS
E
DQEAIQAQKIWKKAIMLVWRAAANH
RYANVFLQPVTDDIAPGYHSIVQRPMDLSTIKKNIENGLIRSTA
E
FQRDIMLMFQNAVMYNSSDHDVYHMAVEMQRDVLEQIQ
QFLATQLIMQTSESGISAKSLRGRDSTRKQD
A
SEK
DSVPMGSPAFLLSLFDGGTRGRRCAIEADMKMKK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser