NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS55071.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55071.1 Public Homo sapiens 6 OPRM1 22 109 92 CCDS HistoryNCBI Gene:4988Re-query CCDS DB by CCDS ID:55071.1Re-query CCDS DB by GeneID:4988See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 55071.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000522236.1 ENSP00000429373.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000522236.1Link to Ensembl Protein Viewer:ENSP00000429373.1Re-query CCDS DB by Nucleotide ID:ENST00000522236Re-query CCDS DB by Protein ID:ENSP00000429373
Original member Current member EBI,WTSI ENST00000522555.5 ENSP00000429719.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000522555.5Link to Ensembl Protein Viewer:ENSP00000429719.1Re-query CCDS DB by Nucleotide ID:ENST00000522555Re-query CCDS DB by Protein ID:ENSP00000429719
Original member Current member EBI,WTSI ENST00000520708.5 ENSP00000430876.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000520708.5Link to Ensembl Protein Viewer:ENSP00000430876.1Re-query CCDS DB by Nucleotide ID:ENST00000520708Re-query CCDS DB by Protein ID:ENSP00000430876
Original member Current member NCBI NM_001145280.3 NP_001138752.1 Accepted alive Link to Nucleotide Sequence:NM_001145280.3Link to Protein Sequence:NP_001138752.1Re-query CCDS DB by Nucleotide ID:NM_001145280Re-query CCDS DB by Protein ID:NP_001138752Link to BLAST:NP_001138752.1
Original member Current member NCBI NM_001145287.2 NP_001138759.1 Accepted alive Link to Nucleotide Sequence:NM_001145287.2Link to Protein Sequence:NP_001138759.1Re-query CCDS DB by Nucleotide ID:NM_001145287Re-query CCDS DB by Protein ID:NP_001138759Link to BLAST:NP_001138759.1
Original member Current member NCBI NM_001285526.1 NP_001272455.1 Accepted alive Link to Nucleotide Sequence:NM_001285526.1Link to Protein Sequence:NP_001272455.1Re-query CCDS DB by Nucleotide ID:NM_001285526Re-query CCDS DB by Protein ID:NP_001272455Link to BLAST:NP_001272455.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001138752.1 300 P35372-12 300 100% 0 0
NP_001138759.1 300 P35372-12 300 100% 0 0
NP_001272455.1 300 P35372-12 300 100% 0 0

Chromosomal Locations for CCDS 55071.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 154089836 154090178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 154090952 154091472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 154118683 154118721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (903 nt):
ATGAAGACTGCCACCAACATCTACATTTTCAACCTTGCTCTGGCAGATGCCTTAGCCACCAGTACCCTGC
CC
TTCCAGAGTGTGAATTACCTAATGGGAACATGGCCATTTGGAACCATCCTTTGCAAGATAGTGATCTC
C
ATAGATTACTATAACATGTTCACCAGCATATTCACCCTCTGCACCATGAGTGTTGATCGATACATTGCA
GTC
TGCCACCCTGTCAAGGCCTTAGATTTCCGTACTCCCCGAAATGCCAAAATTATCAATGTCTGCAACT
GG
ATCCTCTCTTCAGCCATTGGTCTTCCTGTAATGTTCATGGCTACAACAAAATACAGGCAAGGTTCCAT
A
GATTGTACACTAACATTCTCTCATCCAACCTGGTACTGGGAAAACCTGCTGAAGATCTGTGTTTTCATC
TTC
GCCTTCATTATGCCAGTGCTCATCATTACCGTGTGCTATGGACTGATGATCTTGCGCCTCAAGAGTG
TC
CGCATGCTCTCTGGCTCCAAAGAAAAGGACAGGAATCTTCGAAGGATCACCAGGATGGTGCTGGTGGT
G
GTGGCTGTGTTCATCGTCTGCTGGACTCCCATTCACATTTACGTCATCATTAAAGCCTTGGTTACAATC
CCA
GAAACTACGTTCCAGACTGTTTCTTGGCACTTCTGCATTGCTCTAGGTTACACAAACAGCTGCCTCA
AC
CCAGTCCTTTATGCATTTCTGGATGAAAACTTCAAACGATGCTTCAGAGAGTTCTGTATCCCAACCTC
T
TCCAACATTGAGCAACAAAACTCCACTCGAATTCGTCAGAACACTAGAGACCACCCCTCCACGGCCAAT
ACA
GTGGATAGAACTAATCATCAGCTAGAAAATCTGGAAGCAGAAACTGCTCCGTTGCCCTAA


Translation (300 aa):
MKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIA
V
CHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQ
GSIDCTLTFSHPTWYWENLLKICVFI
F
AFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTI
P
ETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSNIEQQNSTRIRQNTRDHPSTAN
T
VDRTNHQ
LENLEAETAPLP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser