NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49944.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49944.1 Public Mus musculus 17 Mpc1 21 106 86 CCDS HistoryNCBI Gene:55951Re-query CCDS DB by CCDS ID:49944.1Re-query CCDS DB by GeneID:55951See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 49944.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000155364 ENSMUSP00000119443 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000155364Link to Ensembl Protein Viewer:ENSMUSP00000119443Re-query CCDS DB by Nucleotide ID:ENSMUST00000155364Re-query CCDS DB by Protein ID:ENSMUSP00000119443
Original member Current member EBI,WTSI OTTMUST00000082287 OTTMUSP00000044088 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000082287Link to Vega Protein Viewer:OTTMUSP00000044088Re-query CCDS DB by Nucleotide ID:OTTMUST00000082287Re-query CCDS DB by Protein ID:OTTMUSP00000044088
Original member NCBI NM_018819.4 NP_061289.1 Updated not alive Link to Nucleotide Sequence:NM_018819.4Link to Protein Sequence:NP_061289.1Re-query CCDS DB by Nucleotide ID:NM_018819Re-query CCDS DB by Protein ID:NP_061289
Current member NCBI NM_018819.5 NP_061289.1 Accepted alive Link to Nucleotide Sequence:NM_018819.5Link to Protein Sequence:NP_061289.1Re-query CCDS DB by Nucleotide ID:NM_018819Re-query CCDS DB by Protein ID:NP_061289Link to BLAST:NP_061289.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061289.1 109 P63030 109 100% 0 0

Chromosomal Locations for CCDS 49944.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 8283891 8283961 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 8293415 8293418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 8296535 8296631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 8296824 8296956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 8297138 8297162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (330 nt):
ATGGCTGGAGCGCTGGTGCGCAAAGCGGCGGACTATGTCCGGAGCAAGGACTTCCGGGACTATCTCATGA
G
T
ACGCACTTCTGGGGCCCAGTTGCCAACTGGGGTCTCCCCATTGCTGCTATCAATGACATGAAGAAATC
T
CCAGAGATTATCAGTGGGCGGATGACTTTCGCCCTCTGTTGCTATTCTCTGACATTCATGAGATTTGCC
TAC
AAGGTACAACCTCGAAACTGGCTTTTGTTTGCATGCCATGTAACAAACGAAGTAGCTCAGCTCATTC
AG
GGAGGACGACTTATCAACTACGAGATGAGTAAGCGGCCATCTGCATAG


Translation (109 aa):
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA
Y
KVQPRNWLLFACHVTNEVAQLIQGGRLINY
EMSKRPSA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser