NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48555.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48555.1 Public Mus musculus 10 Ascc3 21 106 86 CCDS HistoryNCBI Gene:77987Re-query CCDS DB by CCDS ID:48555.1Re-query CCDS DB by GeneID:77987See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 48555.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035606 ENSMUSP00000036726 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035606Link to Ensembl Protein Viewer:ENSMUSP00000036726Re-query CCDS DB by Nucleotide ID:ENSMUST00000035606Re-query CCDS DB by Protein ID:ENSMUSP00000036726
Original member Current member NCBI NM_198007.2 NP_932124.2 Accepted alive Link to Nucleotide Sequence:NM_198007.2Link to Protein Sequence:NP_932124.2Re-query CCDS DB by Nucleotide ID:NM_198007Re-query CCDS DB by Protein ID:NP_932124Link to BLAST:NP_932124.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_932124.2 2198 E9PZJ8-1 2198 100% 0 0

Chromosomal Locations for CCDS 48555.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 50604793 50604882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50607920 50608070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50617712 50618271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50637908 50638028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50642523 50642730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50644943 50645084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50645663 50645788 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50649109 50649309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50649793 50649933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50650547 50650711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50658918 50659094 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50660655 50660726 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50690115 50690249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50699940 50700131 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50700432 50700656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50707663 50707782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50710880 50711044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50713176 50713262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50714266 50714442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50716485 50716710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50718292 50718446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50720612 50720710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50721773 50721941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50728090 50728310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50729912 50729997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50731613 50731779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50732422 50732567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50732687 50732807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50735210 50735352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50748806 50748943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50749035 50749155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50750453 50750585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50753997 50754122 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50767091 50767202 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50767373 50767507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50823636 50823860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50840298 50840449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50842143 50842290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50845531 50845740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50849471 50849646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 50850461 50850593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6597 nt):
ATGGCTCTACCTCGGCTCACAGGAGCCTTGCGCTCCTTTTCAAATGTCACCAAGCAAGATAATTACAATG
AA
GAAGTAGCTGACTTGAAGTTGAAGCGATCTAAACTTCATGAACAAGTTTTAGATTTTGGCCTTACATG
G
AAGAAGATAGTGAAATTTTTGAATGAAAAGCTAGAGAAGAATAAAATGCAAAATATAAATGAAGACTTA
AAA
GACATACTACAAGCTGCAAAACAAATCGTTGGAACGGATAATGGGAGAGAAGCAATTGAGAGTGGGG
CT
GCATTTCTCTTTATGACATTTCACATGACGGACTCTGTTGGTTACATGGAGACAAAGGCTATCAGACA
G
ACGTTTGGTCCCTTTCCATCGTCATCTGCTACTTCAGCTTGTAATGCCACTAATCGAATTATTTCTCAT
TTT
AGTCAAGATGATCTCACTGCTTTTGTCCAGATGGCAGAAAACCCATGTAACGATAGAGTGGTTTTTG
GC
AAAAACTTAGCATTTTCTTTTGACATGTATGATCTGGACCACTTTGATGAATTACCAATAAATGGTGA
A
TCCCAGAAAACTATAAGCTTAGACTACAAGAAGTTCCTGAATGAACAGTTCCAGGAACCCTACACTCCT
GAG
CTCAAGCCTGTGGAGAAAACAAATGGCTCCCTATTGTGGTGTGAAGTTGAGAAGTACTTAAACGCAA
CG
TTAAAGGAAATGACTGAAGCAGCAAGAGTTGAAGATCTTTGCTGTACTCTATATGACATGCTTGCTTC
T
GCTAAAAGCGGCGATGAACTTCAGGACGAGCTGTTTGAATTGCTGGGACCTGAAGGACTGGATCTGATT
GAG
AAGCTGCTCCAGAACAGAATTACAATTGTAGATCGGTTCCTTAATTCCTCGAGCGATCATAAGTTTC
AA
GTTCTCCAAGATAGTTGTAAAAAGATTTTAGGAGAGAATTCAAAGCCTAATTATGGATGTCAAGTCAC
T
ATTCAATCTGAACAAGAAAAACAGTTAATGAAACAATATCGACGTGAAGAAAAAAGAATTGCCAGGCGA
GAA
AAAAAGGCTGGAGAAGATGGGGAAGTTTCTGGAGAAGGAGTTTTGCCCTTTGATCCTAAGGAACTCC
GG
ATACAGAGAGAACATGCACTTCTGAATGCTAGAAATGCTCCAATTTTAGGAAGACAGAGAGACGTGGA
G
TTTGAAAAAATCCGTTATCCTCATGTTTATGATTCCCAGGCTCAGGCCCGAGAAACATCAGCATTCATA
GCT
GGAGCCAAGATGATTTTACCAGAAGGAATCCAGAGAGAGAATACCAAGCTGTATGAGGAAGTCAGGA
TC
CCCTATGGTGAACCAATGCCAGTTGGGTTTGAGGAAAAACCAGTTTATATCAAAGATTTAGATGAGGT
T
GGACAGTTGGCTTTTAAAGGAATGAAGAGACTCAATAGAATCCAGTCTATAGTATTTGAAACAGCCTAC
AAC
ACCAACGAAAACATGCTGATCTGTGCCCCTACGGGAGCTGGGAAGACCAATATTGCAATGCTTACTA
TC
TTACATGAAATCCGCCAACACTTTCATCAAGGTGTTATTAAAAAGAATGAGTTTAAGATTGTGTATGT
C
GCTCCAATGAAAGCCTTGGCAGCTGAGATGACAAATTACTTCAGCAAACGTCTAGAGCCACTGGGCATT
GTT
GTGAAAGAATTGACTGGAGATATGCAGTTGTCAAAAAGTGAAATTTTACGAACTCAGATGCTGGTGA
CC
ACACCAGAAAAATGGGATGTAGTAACAAGAAAGAGTGTTGGGGATGTTGCTCTTTCCCAAATCGTAAA
A
CTCCTGATTCTTGACGAGGTGCACTTGCTGCATGAAGACAGAGGCCCAGTGCTAGAAAGCATAGTCGCC
AGG
ACCTTACGGCAGGTTGAATCCACACAGAGTATGATAAGAATTCTTGGATTGTCTGCAACCTTACCCA
AC
TACCTCGATGTTGCTACATTTTTGCATGTTAACCCCTACATTGGACTTTTCTACTTTGATGGCCGTTT
T
CGACCTGTACCTCTTGGACAGACATTTTTAGGGATTAAAAGTACAAACAAGATGCAGCAGTTAAATAAC
ATG
GATGAAGTGTGCTACGAAAGTGTTCTGAAACAAGTAAAGGCTGGACACCAGGTGATGGTATTTGTAC
AT
GCTCGCAATGCCACTGTAAGGACCGCTATGTCTCTAATAGAGAGAGCAAAAAATAGTGGCCAAATTTC
T
TGCTTTCTACCCACCGAAGGGCCAGAGTACGGACATGCATTAAAACAGGTACAAAAGTCAAGAAATAAG
CAA
GTGCGAGAATTATTCTCCGATGGCTTTAGCATTCATCATGCCGGGATGCTTCGGCAAGACAGAAATT
TG
GTTGAAAATTTGTTTTCAAATGGGCATATCAAAGTCCTAGTCTGTACAGCCACATTAGCCTGGGGTGT
C
AATCTTCCTGCACATGCCGTGGTTATTAAGGGAACACAAATATACGCTGCCAAAAGAGGCTCCTTTGTT
GAC
CTTGGAATTTTAGATGTCATGCAGATATTTGGCCGAGCTGGACGACCGCAATTTGACAAATTTGGGG
AA
GGAATCATTATAACAACCCACGATAAACTCAGCCATTACCTCAGTTTGCTCACTCAACAAAACCCAAT
T
GAGAGTCAGTTTCTGGAAAGTCTTGCAGATAACCTAAATGCAGAGATTGCGCTGGGGACAGTCACCAAC
GTG
GAAGAGGCAGTGAGGTGGATGAGTTACACTTACCTCTATGTGCGCATGCGAGCAAACCCGCTAGCAT
AC
GGCATCAGTCACAAAGCGTACCAGATTGACCCAACACTAAGGAAGCATCGAGAACAGCTCCTTATTGA
A
GTTGGACAAAAGTTGGATAAAGCAAAGATGATTCGTTTTGAAGAACGAACTGGCTATTTTTCTTCTACT
GAT
TTGGGTAGAACTGCCAGCCACTTCTATATTAAATACAACACCATTGAGACATTTAATGAACTCTTTG
AT
GCACACAAAACAGAGGGTGATATCTTTGCTATTGTTTCCAAAGCTGAAGAATTTGATCAAATTAAGGT
C
AGAGAAGAAGAAATAGAAGAATTAGATGCCTTGTTAAACAATTTCTGTGAACTCTCAGCTCCAGGAGGT
GTG
GAAAATAGTTATGGGAAAATAAATATCCTACTTCAAACCTACATCAGCCGAGGAGAGATGGACAGTT
TC
TCCCTCATATCAGATTCTGCATATGTCGCCCAGAATGCAGCTAGAATTGTCCGTGCTCTCTTTGAAAT
T
GCACTGAGGAAACGTTGGCCTACCATGACCTACAGGCTTTTGAATCTTAGTAAAGTCATTGACAAGAGA
CTC
TGGGGTTGGGCTAGCCCTTTGAGACAATTTTCTGTGTTACCACCACACATTCTAACAAGATTAGAAG
AA
AAAAACCTTACTGTGGATAAACTCAAAGACATGAGAAAAGATGAAATAGGTCACATTTTGCATCATGT
G
AATATTGGACTGAAGGTCAAACAGTGTGTTCATCAAATTCCTTCTGTTACAATGGAAGCTTCCATTCAG
CCC
ATCACACGGACTGTCCTCCGAGTATCACTGAACATCCACCCTGATTTCTCTTGGAATGACCAGGTTC
AT
GGAACAGTGGGGGAACCATGGTGGATTTGGGTAGAAGATCCTACAAATGACCATATTTATCACTCGGA
G
TACTTTCTAGCTCTTAAAAAACAGGTTATTAATAAGGAAGCTCAACTTCTGGTATTTACAATTCCTATT
TTT
GAGCCTTTGCCCTCTCAGTACTACATTCGAGCAGTGTCTGATCGATGGCTAGGAGCTGAAGCTGTTT
GC
ATTATCAACTTTCAACATCTGATTCTACCAGAGAGACATCCTCCCCATACAGAATTATTGGACCTTCA
A
CCTTTACCAATTACAGCTTTGGGGTGCAAAGCATATGAAGCTCTATATAACTTCAGCCACTTTAACCCT
GTA
CAGACGCAGATATTCCACACACTGTATCACACAGACTGTAATGTTCTGCTTGGCGCCCCCACCGGAT
CA
GGAAAGACAGTTGCAGCTGAACTAGCCATTTTCAGAGTTTTCAACAAATATCCTACTTCAAAGGCAGT
A
TATATTGCACCCCTCAAAGCTCTAGTACGTGAAAGAATGGATGATTGGAAAATTAGGATAGAAGAAAAA
CTT
GGTAAAAAAGTTATTGAACTAACTGGGGATGTGACTCCAGACATGAAATCCATTGCTAAGGCTGACC
TT
ATTGTCACCACACCAGAAAAGTGGGATGGAGTTAGTCGAAGCTGGCAGAATAGAAGCTATGTTCAGCA
G
GTCAACATTCTCATCATAGATGAGATCCATCTGCTAGGGGAGGAGAGAGGCCCAGTTTTAGAAGTCATT
GTA
TCTCGAACAAACTTTATCTCATCACACACAGAAAAACCAGTTAGAATAGTTGGACTGTCCACTGCAT
TA
GCTAATGCTAGAGATCTTGCTGACTGGCTCAACATTAAGCAGATGGGTTTGTTTAACTTCCGACCATC
A
GTTCGCCCAGTTCCACTGGAAGTTCACATTCAGGGTTTCCCAGGACAACATTACTGCCCACGCATGGCT
AGT
ATGAACAAGCCTGCATTTCAGGCAATTAGAAGTCACTCTCCAGCCAAGCCTGTTTTGATATTTGTCT
CA
TCAAGACGTCAAACACGACTTACAGCCTTAGAGTTGATAGCATTTCTGGCCACTGAAGAAGACCCAAA
G
CAGTGGTTGAATATGGATGAGCAAGAGATGGACAACATCATTGGAACAGTACGAGATTCCAACCTCAAG
CTG
ACTCTAGCTTTTGGAATAGGAATGCATCATGCTGGCCTGCATGAAAGAGACCGAAAAACTGTAGAAG
AG
CTGTTTGTGAACTGTAAAGTTCAGGTTCTCATTGCTACAAGCACATTAGCATGGGGTGTAAACTTTCC
A
GCACACTTAGTAATTATTAAGGGAACTGAATATTATGATGGAAAGACAAGACGTTATGTGGATTTTCCC
ATC
ACAGATGTGCTGCAGATGATGGGACGAGCTGGGAGACCTCAGTTTGATGACCAGGGCAAAGCTGTAA
TT
CTAGTTCATGATATAAAAAAAGATTTTTATAAAAAGTTTCTTTATGAACCTTTCCCAGTAGAATCAAG
C
TTATTAGGAGTGTTGTCTGACCACTTAAATGCAGAGATTGCTGGAGGTACAATAACATCAAAGCAAGAT
GCA
ATGGATTATATCACCTGGACTTACTTTTTCCGGCGTCTTATCATGAATCCCAGCTACTACAGCTTGG
GT
GACGTCAGCCAGGACTCCATAAACAAGTTCCTGTCACATCTGATTGGGCAGTCTCTGGTTGAATTGGA
G
CTTTCCCACTGCATTGAAGTTGGAGAGGATAATCGCACCATTGAACCACTGACATGTGGTCGAATTGCC
TCC
TATTACTATTTGAAGCACAAAACTGTCAAAATGTTCAAGGACCGTTTGAAACCTGAGTGCAGCACTG
AG
GAACTGCTGTCAATTCTGAGTGATGCAGAAGAATACACAGACTTACCAGTAAGACACAATGAGGACCA
T
ACGAATAATGAATTGGCCAAATGTCTTCCCATTGAATTAAATCCTCATTCATTTGACAGCCCTCACACC
AAA
GCCCATCTCTTGCTTCAAGCGCATCTCAGCCGAGCCATGCTGCCCTGCCCAGATTATGATACTGATA
CC
AAAACAGTCTTAGACCAAGCTCTCAGAGTATGCCAGGCAATGCTGGATGTGGCTGCAAGCCAGGGATG
G
CTAGTGACCGTCCTGAATATCACCCACCTGATTCAGATGGTGATCCAAGGCCGATGGCTCAAGGACTCT
TCT
CTTCTCACAATACCAAACATAGAGCAGCACCACCTTCACCTTTTCAGGAAATGGAAGCCACCTGTAA
AG
AGCTCACATGCTAAGTGCCGAACATCCATTGAGTGCCTTCCTGAGCTGATCCATGCCTGTGAAGGGAA
G
GACCATGTGTTCAGCTCCATGGTAGAGAAAGAGTTACAGCCTGCAAAAACAAAGCAGGCATGGAATTTC
TTA
TCTCGCTTGCCAGTGATAAATGTTGGCATAAGTGTTAAAGGCTCATGGGATGACTTAGTTGAAGGAC
AT
AATGAACTCTCCATCTCAACTCTGACAGCAGACAAACGGGATGAAAACAAATGGATCAAGTTGCATGC
T
GATCAGGAGTATGTGCTTCAAGTCAGCCTACAGAGAGTCCATTTTGGGCTTCCAAAGGGAAAACATGAG
AAT
CACGCAGTTACTCCTCGATTTCCAAAATTAAAAGATGAAGGCTGGTTTTTGATATTAGGAGAAGTGG
AT
AAGAGAGAGCTGATGGCTGTAAAACGAGTAGGATTTGTTCGAACACATCATGATGCTTCCATCTCGTT
C
TTTACTCCTGAAACACCTGGAAGATATATCTTTACCCTGTATCTCATGAGTGACTGTTACCTCGGCCTA
GAC
CAGCAGTATGACATTTATCTCAATGTCATAAAAGCAAACATTTCTACAAAGGACTCTGATGTCTTCA
CT
GACTTGTCAGTATAG


Translation (2198 aa):
MALPRLTGALRSFSNVTKQDNYNEEVADLKLKRSKLHEQVLDFGLTWKKIVKFLNEKLEKNKMQNINEDL
K
DILQAAKQI
VGTDNGREAIESGAAFLFMTFHMTDSVGYMETKAIRQTFGPFPSSSATSACNATNRIISH
F
SQDDLTAFVQMAENPCNDRVVFGKNLAFSFDMYDLDHFDELPINGESQKTISLDYKKFLNEQFQEPYTP
E
LKPVEKTNGSLLWCEVEKYLNATLKEMTEAARVEDLCCTLYDMLASAKSGDELQDE
LFELLGPEGLDLI
E
KLLQNRITIVDRFLNSSSDHKFQVLQ
DSCKKILGENSKPNYGCQVTIQSEQEKQLMKQYRREEKRIARR
E
KKAGEDGEVSGEGVLPFDPKELRIQ
REHALLNARNAPILGRQRDVEFEKIRYPHVYDSQAQARETSAFI
A
GAK
MILPEGIQRENTKLYEEVRIPYGEPMPVGFEEKPVYIKDLDEVGQLAFKGMKRLNRIQSIVFETAY
N
TNENMLICAPTGAGKTNIAMLTILHEIRQHFHQGVIKKNEFK
IVYVAPMKALAAEMTNYFSKRLEPLGI
V
VKELTGDMQLSKSEILRTQ
MLVTTPEKWDVVTRKSVGDVALSQIVKLLILDEVHLLHEDRGPVLESIVA
R
TLRQ
VESTQSMIRILGLSATLPNYLDVATFLHVNPYIGLFYFDGRFRPVPLGQTFLGIKSTNKMQQLNN
M
DEVCYESVLKQVKAGHQ
VMVFVHARNATVRTAMSLIERAKNSGQISCFLPTEGPEYGHALKQVQKSRNK
Q
VRELFSDGFSIHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVVIK
GTQIYAAKRGSFV
D
LGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLSLLTQQNPIESQFLESLADNLNAE
IALGTVTN
V
EEAVRWMSYTYLYVRMRANPLAYGISHKAYQ
IDPTLRKHREQLLIEVGQKLDKAKMIRFEERTGYFSST
D
LGRTASHFYIKYNTIE
TFNELFDAHKTEGDIFAIVSKAEEFDQIKVREEEIEELDALLNNFCELSAPGG
V
ENSYGKINILLQTYISRGEMDSFSLISDSAYVAQ
NAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKR
L
WGWASPLRQFSVLPPHILTRLEEKNLTVDKLKDMRKDEI
GHILHHVNIGLKVKQCVHQIPSVTMEASIQ
P
ITRTVLRVSLNIHPDFSWNDQ
VHGTVGEPWWIWVEDPTNDHIYHSEYFLALKKQVINKEAQLLVFTIPI
F
EPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHT
ELLDLQPLPITALGCKAYEALYNFSHFNP
V
QTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSK
AVYIAPLKALVRERMDDWKIRIEEK
L
GK
KVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQNRSYVQQVNILIIDEIHLLGEERGPVLEVI
V
SRTNFISSHTEKPVRIVGLSTALANARDLADWLNIKQ
MGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMA
S
MNKPAFQ
AIRSHSPAKPVLIFVSSRRQTRLTALELIAFLATEEDPKQWLNMDEQEMDNIIGTVRDSNLK
L
TLAFGIGMHHAGLHERDRKTVEELFVNCKVQ
VLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFP
I
T
DVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEIAGGTITSKQD
A
MDYITWTYFFRRLIMNP
SYYSLGDVSQDSINKFLSHLIGQSLVELELSHCIEVGEDNRTIEPLTCGRIA
S
YYYLKHKTVKMFKDRLKPECSTEELLSILS
DAEEYTDLPVRHNEDHTNNELAKCLPIELNPHSFDSPHT
K
AHLLLQAHLSRAMLPCPDYDTDTKTVLDQALRVCQ
AMLDVAASQGWLVTVLNITHLIQMVIQGRWLKDS
S
LLTIPNIEQHHLHLF
RKWKPPVKSSHAKCRTSIECLPELIHACEGKDHVFSSMVEKELQPAKTKQAWNF
L
SRLPVINVGISVKGSWDDLVEGHNELSISTLTADKRDENKWIKLHADQEYVLQVSLQRVHFGLPK
GKHE
N
HAVTPRFPKLKDEGWFLILGEVDKRELMAVKRVGFVRTHHDASISFFTPETPG
RYIFTLYLMSDCYLGL
D
QQYDIYLNVIKANISTKDSDVFTDLSV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser