NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40669.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40669.1 Public Mus musculus 9 Clpx 21 106 86 CCDS HistoryNCBI Gene:270166Re-query CCDS DB by CCDS ID:40669.1Re-query CCDS DB by GeneID:270166See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 40669.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113824 ENSMUSP00000109455 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113824Link to Ensembl Protein Viewer:ENSMUSP00000109455Re-query CCDS DB by Nucleotide ID:ENSMUST00000113824Re-query CCDS DB by Protein ID:ENSMUSP00000109455
Original member Current member NCBI NM_001044389.2 NP_001037854.1 Accepted alive Link to Nucleotide Sequence:NM_001044389.2Link to Protein Sequence:NP_001037854.1Re-query CCDS DB by Nucleotide ID:NM_001044389Re-query CCDS DB by Protein ID:NP_001037854Link to BLAST:NP_001037854.1

Chromosomal Locations for CCDS 40669.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 65294487 65294565 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65299901 65300064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65301848 65301965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65308468 65308622 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65310152 65310311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65316644 65316820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65317329 65317493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65318663 65318751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65320819 65320983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65322544 65322843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65324207 65324299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65326782 65326888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 65329814 65329904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1863 nt):
ATGTCCAGTTGCGGCGCTTGTACCTGCGGCGCTGCGGCCGCCCGGCTTCTCACCACTTCGCTCACCTCCG
CG
CAGAGAGGTATTTCGTGTGGGCGAATCCATGTGCCAGTGTTAGGAAGACTGGGGACGACCTTGGACGC
T
CAGGCTCTGCGCAGAGCTCCTCTTAGAACCTTTTCAGAAACACCAGCATACTTTGCCTCAAAAGACGGG
GCA
AACAAGGATGGCTCCGGAGATGGAAATAAGAAATCAGTGACTGAAGGAAGCAGTAAGAAATCAGGCT
CT
GGGAATTCTGGGAAAGGTGGAAACCAGCTTCGCTGTCCTAAATGTGGTGATTTGTGTACACACGTGGA
G
ACCTTTGTGTCTTCCACGCGTTTTGTTAAGTGTGAAAAATGTCATCATTTTTTTGTGGTGCTGTCGGAA
GCA
GACTCAAAGAAAAGCATAATTAAGGAACCCGAGTCCGCTGCAGAGGCTGTGAAGTTGGCATTCCAGC
AG
AAGCCACCTCCGCCCCCCAAAAAGATTTATAACTACCTCGACAAGTATGTTGTTGGCCAGTCGTTTGC
T
AAGAAAGTGCTTTCAGTTGCCGTGTATAATCATTATAAGAGAATATATAATAATATTCCAGCTAATCTG
AGA
CAGCAAGCAGAGGCTGAGAAGCAGACATCACTAACACCTAGAGAGTTGCTTCAGATCGCTGGGATCA
GC
CCACACGGCAATGCCTTGGGAGCCTCTATGCAGCAGCAGGTAAACCAGCAAATGCCTCAGGAGAAAAG
A
GGAGGTGAAGTGTTGGACTCTTCTCAAGATGATATAAAACTGGAAAAAAGTAATATTTTGCTGCTTGGA
CCA
ACTGGGTCAGGTAAAACCCTTCTGGCACAAACTTTAGCTAAATGCCTTGATGTTCCTTTTGCTATCT
GT
GACTGTACAACTTTGACCCAGGCTGGATATGTAGGTGAAGATATTGAATCTGTGATTGCCAAACTACT
C
CAAGATGCCAATTACAATGTAGAGAAAGCACAACAAGGAATTGTCTTTCTGGATGAAGTAGATAAGATT
GGC
AGTGTGCCAGGCATTCATCAATTACGGGATGTAGGTGGAGAAGGCGTTCAGCAAGGTTTATTAAAAC
TT
CTAGAAGGCACAATAGTCAATGTTCCAGAAAAGAATTCTCGAAAACTACGTGGAGAGACAGTTCAAGT
T
GATACAACAAATGTCTTGTTTGTGGCATCTGGTGCCTTTAATGGCTTAGACAGAATCATCAGCAGGAGG
AAA
AATGAAAAGTATCTCGGCTTTGGAACACCATCTAACCTGGGAAAGGGCAGAAGGGCTGCAGCTGCAG
CG
GATCTTGCTAACCGAAGTGGGGAATCTAACACTCATCAGGACATTGAGGAGAAAGACCGGTTACTCCG
C
CATGTGGAAGCCAGAGATCTTATTGAGTTTGGCATGATACCAGAGTTTGTGGGACGGTTGCCTGTGGTG
GTT
CCTTTGCACAGCCTAGATGAGAAGACACTTGTACAAATACTGACCGAGCCACGGAATGCTGTTATTC
CT
CAGTATCAGGCCTTGTTCAGCATGGATAAGTGTGAGCTGAATGTTACTGAGGATGCTCTGAAAGCCAT
A
GCGAGATTGGCCCTGGAAAGAAAAACAGGTGCACGAGGCCTTCGGTCTATAATGGAAAAGCTGTTACTA
GAA
CCAATGTTCGAAGTTCCTAATTCTGACATTGTATGTGTGGAAGTTGACAAAGAAGTAGTAGAAGGCA
AA
AAGGAACCAGGATACATTCGGGCACCCTCAAAAGAGTCCTCTGAAGAGGAATATGACTCTGGAGTGGA
G
GAGGATGGATGGCCTCGTCAAGCGGATGCTGCAAACAGCTAA


Translation (620 aa):
MSSCGACTCGAAAARLLTTSLTSAQRGISCGRIHVPVLGRLGTTLDAQALRRAPLRTFSETPAYFASKDG
A
NKDGSGDGNK
KSVTEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSE
A
DSKKSIIKEPESAAEAVKLAFQQKPPPPPKK
IYNYLDKYVVGQSFAKKVLSVAVYNHYKRIYNNIPANL
R
QQAEAEKQTSLTPR
ELLQIAGISPHGNALGASMQQQVNQQMPQEKRGGEVLDSSQDDIKLEKSNILLLG
P
TGS
GKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEVDKI
G
SVPGIHQLRDVGGEGVQQ
GLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNVLFVASGAFNGLDRIISRR
K
NEK
YLGFGTPSNLGKGRRAAAAADLANRSGESNTHQDIEEKDRLLRHVEARDLIEFGMIPEFVGRLPVV
V
PLHSLDEKTLVQILTEPRNAVIPQYQALFSMDK
CELNVTEDALKAIARLALERKTGARGLRSIMEKLLL
E
PMFEVPNSDIVCVEVDKEVVEGKKEPGYI
RAPSKESSEEEYDSGVEEDGWPRQADAANS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser