NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36432.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36432.1 Public Mus musculus 12 Hdac9 21 106 86 CCDS HistoryNCBI Gene:79221Re-query CCDS DB by CCDS ID:36432.1Re-query CCDS DB by GeneID:79221See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36432.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000110819 ENSMUSP00000106443 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110819Link to Ensembl Protein Viewer:ENSMUSP00000106443Re-query CCDS DB by Nucleotide ID:ENSMUST00000110819Re-query CCDS DB by Protein ID:ENSMUSP00000106443
Original member Current member EBI,WTSI OTTMUST00000149853 OTTMUSP00000077716 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000149853Link to Vega Protein Viewer:OTTMUSP00000077716Re-query CCDS DB by Nucleotide ID:OTTMUST00000149853Re-query CCDS DB by Protein ID:OTTMUSP00000077716
Original member Current member NCBI NM_024124.3 NP_077038.2 Accepted alive Link to Nucleotide Sequence:NM_024124.3Link to Protein Sequence:NP_077038.2Re-query CCDS DB by Nucleotide ID:NM_024124Re-query CCDS DB by Protein ID:NP_077038Link to BLAST:NP_077038.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077038.2 588 Q99N13-1 588 99.8299% 0 1

Chromosomal Locations for CCDS 36432.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 34373827 34374138 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34389245 34389462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34390142 34390352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34393283 34393405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34402752 34402867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34407766 34407897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34429498 34429619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34431863 34431989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34433081 34433222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34437137 34437378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 34528283 34528304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1767 nt):
ATGCACAGTATGATCAGCTCAGTGGACGTGAAATCAGAGGTTCCTATGGGCCTGGAGCCCATCTCACCTT
TA
GACCTGAGGACAGATCTCAGGATGATGATGCCTGTGGTGGATCCTGTCGTCCGCGAGAAGCAACTGCA
G
CAAGAGTTACTTCTTATTCAGCAGCAGCAGCAGATCCAGAAGCAGCTCCTCATAGCAGAGTTTCAGAAG
CAG
CACGAGAATTTGACAAGGCAGCATCAAGCACAACTCCAGGAGCACATCAAGGAACTTCTAGCCATAA
AA
CAACAGCAAGAACTCCTAGAAAAGGAGCAGAAACTGGAGCAGCAGAGGCAAGAACAGGAAGTAGAGAG
G
CATCGCAGAGAGCAGCAGCTTCCTCCTCTCAGAGGCAAAGATAGAGGACGAGAAAGGGCAGTGGCAAGC
ACA
GAGGTTAAGCAGAAGCTTCAAGAATTCCTGTTGAGTAAATCAGCAACAAAAGACACTCCAACCAATG
GA
AAGAATCATTCCGTGGGCCGCCATCCCAAGCTCTGGTACACGGCTGCCCACCACACATCACTGGATCA
A
AGCTCTCCACCCCTCAGTGGAACGTCTCCATCCTACAAGTACACATTACCAGGAGCTCAAGATAGCAAG
GAT
GATTTCCCCTTGAGAAAAACTGCCTCAGAGCCCAACTTGAAGGTGCGGTCCAGGTTAAAACAGAAAG
TG
GCAGAGAGGAGAAGCAGTCCCTTACTCAGGCGGAAGGATGGAAATCTTGTCACTTCATTCAAGAAGCG
A
GTGTTTGAGGTGGCAGAATCCTCGGTCAGTAGCAGCTCTCCAGGGTCAGGTCCCAGTTCACCAAACAAT
GGC
CCTGCTGGGAATGTGACCGAAAATGAGGCTTCAGCTCTGCCTCCCACGCCTCACCCCGAGCAACTGG
TT
CCACAGCAGCGCATACTAATTCATGAAGATTCCATGAACCTGCTAAGTCTCTATACCTCCCCGTCCCT
G
CCCAATATCACTCTGGGACTTCCAGCAGTGCCGTCCCCACTCAATGCTTCTAACTCACTCAAAGACAAA
CAG
AAGTGCGAGACACAGATGCTCAGACAAGGTGTTCCTCTGCCCAGTCAGTATGGCAGTAGCATTGCAG
CG
TCCTCCAGCCACGTTCATGTAGCAATGGAAGGAAAACCCACCAGCAGCCACCAGGCTCTCCTGCAGCA
C
CTACTGCTGAAGGAACAAATGCGACAGCAAAAGCTTCTCGTGGCTGGTGGAGTTCCATTACACCCTCAG
TCT
CCTTTGGCAACAAAAGAAAGAATTTCACCAGGCATTAGAGGTACCCACAAATTGCCCCGCCACCGAC
CC
CTGAATCGAACCCAGTCTGCACCTTTGCCTCAGAGCACGCTGGCTCAGCTGGTCATTCAGCAGCAGCA
C
CAGCAGTTCCTGGAGAAGCAGAAACAATACCAGCAGCAGATCCACATGAACAAACTGCTATCGAAATCT
ATT
GAACAACTGAAGCAACCAGGCAGCCACCTTGAAGAAGCAGAGGAGGAGCTTCAGGGGGACCAATCCA
TG
GAAGACAGAGCAGCCTCTAAGGACAACAGTGCTAGGAGTGACAGCAGTGCTTGTGTGGAGGACACGCT
G
GGACAAGTTGGGGCTGTGAAGGTCAAGGAGGAACCCGTGGACAGCGATGAAGATGCTCAGATACAGGAA
ATG
GAATGTGGGGAGCAGGCTGCTTTTATGCAACAGGTAATAGGCAAAGATTTAGCTCCAGGATTTGTAA
TT
AAAGTCATTATTTGA


Translation (588 aa):
MHSMISSVDVKSEVPMGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQK
Q
HENLTRQHQAQLQEHIK
ELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVAS
T
EVKQKLQEFLLSKSATKDTPTNGKNHSVGRHPKLWY
TAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDSK
D
DFPLRKT
ASEPNLKVRSRLKQKVAERRSSPLLRRKDGNLVTSFKKRVFEVAESSVSSSSPGSGPSSPNN
G
PAGNVTENEASALPPTPHPE
QLVPQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSPLNASNSLKDK
Q
KCETQMLRQGVPLPSQYGSSIAASSSHVHVAMEGKPTSSHQALLQHLLLKEQMRQQKLLVA
GGVPLHPQ
S
PLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNK
LLSKS
I
EQLKQPGSHLEEAEEELQGDQSMEDRAASKDNSARSDSSACVEDTLGQVGAVKVKEEPVDSDEDAQIQE
M
ECGEQAAFMQQVIGKDLAPGFVIKVII




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser