NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35652.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35652.1 Public Mus musculus 1 Eif4e2 21 106 86 CCDS HistoryNCBI Gene:26987Re-query CCDS DB by CCDS ID:35652.1Re-query CCDS DB by GeneID:26987See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35652.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113233 ENSMUSP00000108859 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113233Link to Ensembl Protein Viewer:ENSMUSP00000108859Re-query CCDS DB by Nucleotide ID:ENSMUST00000113233Re-query CCDS DB by Protein ID:ENSMUSP00000108859
Original member Current member EBI,WTSI OTTMUST00000051660 OTTMUSP00000024354 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051660Link to Vega Protein Viewer:OTTMUSP00000024354Re-query CCDS DB by Nucleotide ID:OTTMUST00000051660Re-query CCDS DB by Protein ID:OTTMUSP00000024354
Original member Current member NCBI NM_001039170.1 NP_001034259.1 Accepted alive Link to Nucleotide Sequence:NM_001039170.1Link to Protein Sequence:NP_001034259.1Re-query CCDS DB by Nucleotide ID:NM_001039170Re-query CCDS DB by Protein ID:NP_001034259Link to BLAST:NP_001034259.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001034259.1 245 Q8BMB3 245 100% 0 0

Chromosomal Locations for CCDS 35652.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 87214000 87214019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87219581 87219695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87220920 87221054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87224353 87224457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87225850 87226002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87226097 87226233 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87227801 87227873 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (738 nt):
ATGAACAACAAGTTCGACGCCTTAAAAGATGATGACAGTGGAGACCATGATCAGAATGAAGAAAACAGCA
CA
CAGAAAGATGGTGAGAAGGAAAAAACAGACCGAGACAAGAGCCAGAGCAGTGGCAAGAGGAAGGCTGT
T
GTCCCTGGACCAGCAGAGCATCCCCTGCAGTACAACTACACCTTTTGGTACTCGAGGAGAACCCCTGGC
CGT
CCCACCAGCTCGCAGAGCTATGAGCAGAACATCAAGCAGATTGGCACCTTTGCCTCTGTGGAGCAGT
TC
TGGAAGTTTTACAGCCACATGGTACGTCCTGGGGACCTGACAGGCCACAGTGACTTTCATCTCTTCAA
A
GAAGGGATTAAACCTATGTGGGAGGATGATGCAAATAAAAATGGGGGCAAGTGGATCATTCGACTCCGG
AAG
GGCTTAGCTTCCCGCTGCTGGGAGAATCTCATCCTGGCTATGCTCGGGGAGCAATTCATGGTTGGGG
AG
GAGATCTGCGGGGCTGTGGTCTCTGTCCGCTTTCAGGAGGACATTATTTCTATATGGAATAAGACTGC
C
AGCGACCAAGCAACTACAGCCCGAATCCGGGATACTCTTCGGCGCGTGCTTAACCTACCTCCCAACACC
ATT
ATGGAATACAAAACTCACACCGACAGCATCAAAATGCCAGGCAGGCTGGGCCCCCAAAGGCTCCTTT
TT
CAAAACCTCTGGAAGCCGCGATTGAATGTGCCATGA


Translation (245 aa):
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPG
R
PTSSQSYEQNIKQIGTFAS
VEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR
K
GLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQ
EDIISIWNKTASDQATTARIRDTLRRVLNLPPNT
I
MEYKTHTDSI
KMPGRLGPQRLLFQNLWKPRLNVP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser