NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS34527.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34527.1 Public Homo sapiens 6 TPD52L1 22 109 92 CCDS HistoryNCBI Gene:7164Re-query CCDS DB by CCDS ID:34527.1Re-query CCDS DB by GeneID:7164See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34527.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000368402.9 ENSP00000357387.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368402.9Link to Ensembl Protein Viewer:ENSP00000357387.5Re-query CCDS DB by Nucleotide ID:ENST00000368402Re-query CCDS DB by Protein ID:ENSP00000357387
Original member Current member NCBI NM_001003396.2 NP_001003396.1 Accepted alive Link to Nucleotide Sequence:NM_001003396.2Link to Protein Sequence:NP_001003396.1Re-query CCDS DB by Nucleotide ID:NM_001003396Re-query CCDS DB by Protein ID:NP_001003396Link to BLAST:NP_001003396.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001003396.1 144 Q16890-2 144 100% 0 0

Chromosomal Locations for CCDS 34527.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 125153952 125153970 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 125220078 125220193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 125229118 125229266 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 125248282 125248383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 125253717 125253755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 125262834 125262843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (435 nt):
ATGGAGGCGCAGGCACAAGGTTTGTTGGAGACTGAACCGTTGCAAGGAACAGACGAAGATGCAGTAGCCA
GT
GCTGACTTCTCTAGCATGCTCTCTGAGGAGGAAAAGGAAGAGTTAAAAGCAGAGTTAGTTCAGCTAGA
A
GACGAAATTACAACACTACGACAAGTTTTGTCAGCGAAAGAAAGGCATCTAGTTGAGATAAAACAAAAA
CTC
GGCATGAACCTGATGAATGAATTAAAACAGAACTTCAGCAAAAGCTGGCATGACATGCAGACTACCA
CT
GCCTACAAGAAAACACATGAAACCCTGAGTCACGCAGGGCAAAAGGCAACTGCAGCTTTCAGCAACGT
T
GGAACGGCCATCAGCAAGAAGTTCGGAGACATGAGTTACTCCATTCGCCATTCCATAAGTATGCCTGCT
ATG
AGACGAAAGTAG


Translation (144 aa):
MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQK
L
GMNLMNELKQNFSKSWHDMQTTT
AYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPA
M
RRK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser