NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32000.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32000.1 Public Homo sapiens 13 FARP1 22 109 92 CCDS HistoryNCBI Gene:10160Re-query CCDS DB by CCDS ID:32000.1Re-query CCDS DB by GeneID:10160See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32000.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000376581.9 ENSP00000365765.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000376581.9Link to Ensembl Protein Viewer:ENSP00000365765.4Re-query CCDS DB by Nucleotide ID:ENST00000376581Re-query CCDS DB by Protein ID:ENSP00000365765
Original member Current member NCBI NM_001001715.3 NP_001001715.2 Accepted alive Link to Nucleotide Sequence:NM_001001715.3Link to Protein Sequence:NP_001001715.2Re-query CCDS DB by Nucleotide ID:NM_001001715Re-query CCDS DB by Protein ID:NP_001001715Link to BLAST:NP_001001715.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001001715.2 129 Q9Y4F1-3 129 100% 0 0

Chromosomal Locations for CCDS 32000.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 98213243 98213413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 98244491 98244709 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (390 nt):
ATGGGAGAAATAGAGCAGAGGCCGACCCCAGGATCACGACTGGGGGCCCCGGAAAATTCGGGGATCAGTA
CC
TTGGAACGTGGACAGAAGCCGCCCCCAACACCTTCAGGAAAACTCGTGTCCATCAAAATCCAGATGCT
G
GATGACACCCAGGAGGCATTTGAAGTTCCAATGGTGTCCTCATCCTCCTTCCTCAAAGCCACCGGCTCC
TCC
TGGACGGGTTGGGTACTGAGATGCTCCATGAAGCCCAAGCACCATTCACATCTAATTGAGAAGTTTG
GA
GAGGACAGAATTCTCACTCATCTTACAGGCTCTATTTCTTACACAAACTGGGCTGGAAGTAGAAGCTT
A
GCGGTCACAGTCACTGAAGAGCTTCTTAATCTTTTTTGA


Translation (129 aa):
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPMVSSSSFLKATGS
S
WTGWVLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAGSRSLAVTVTEELLNLF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser