NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24486.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24486.1 Public Mus musculus 11 Vrk2 21 106 86 CCDS HistoryNCBI Gene:69922Re-query CCDS DB by CCDS ID:24486.1Re-query CCDS DB by GeneID:69922See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24486.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000078362 ENSMUSP00000077471 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000078362Link to Ensembl Protein Viewer:ENSMUSP00000077471Re-query CCDS DB by Nucleotide ID:ENSMUST00000078362Re-query CCDS DB by Protein ID:ENSMUSP00000077471
Original member Current member EBI,WTSI ENSMUST00000109504 ENSMUSP00000105130 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109504Link to Ensembl Protein Viewer:ENSMUSP00000105130Re-query CCDS DB by Nucleotide ID:ENSMUST00000109504Re-query CCDS DB by Protein ID:ENSMUSP00000105130
Original member Current member EBI,WTSI OTTMUST00000018383 OTTMUSP00000008449 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000018383Link to Vega Protein Viewer:OTTMUSP00000008449Re-query CCDS DB by Nucleotide ID:OTTMUST00000018383Re-query CCDS DB by Protein ID:OTTMUSP00000008449
Original member Current member NCBI NM_027260.3 NP_081536.2 Accepted alive Link to Nucleotide Sequence:NM_027260.3Link to Protein Sequence:NP_081536.2Re-query CCDS DB by Nucleotide ID:NM_027260Re-query CCDS DB by Protein ID:NP_081536Link to BLAST:NP_081536.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081536.2 503 Q8BN21-1 503 100% 0 0

Chromosomal Locations for CCDS 24486.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 26471445 26471786 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26476554 26476700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26483158 26483324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26486960 26487018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26489773 26489893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26498917 26499049 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26534211 26534303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26535537 26535642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26547839 26547926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26549295 26549364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26550026 26550075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 26591587 26591722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1512 nt):
ATGGCACCAAGAAGAAAAGAGAAATATAAGCTTCCGGTTCCACTCCCAGAAGGCAAAATTCTGGATGATA
TG
GAAGGAAACCGGTGGGCACTGGGCAAGATGATCGGCTCTGGAGGGTTTGGACTGATATACTTAGCTTT
C
CCCACAAATAAACCAAACAAAGATGCAAGACATGTCATAAAGCTGGAGTATCAAGAAAATGGCCCATTA
TTT
TCAGAGCTTAAATTTTATCAGAGAGCTGCAAAAAGAGAATGTATCCAAAAGTGGATACAACAGAGGA
AA
CTTGATTATTTAGGAATTCCTGTATTTTATGGATTTGGTCTGACTGATTTCAAAGGAAGAAGTTACAG
A
TTCATGGTAATGGAAAGACTTGGAATAGATTTACAGAAACTCCTGGACCAGAATGGTGGTTTTAAAAAA
TTA
ACCGTCCTACAACTTGGCATCAGGATGCTGGATGTACTGGAATATATACATGAAAATGAGTATGTTC
AT
GGTGATATAAAAGCCGCAAATCTACTGTTGGATTTTACAAATCCAGACCGGGTTTATCTTGCAGACTA
T
GGACTTTCCTACAGATATTGTCCCAATGGGAACCACAAACAGTATCAGGAAGATCCCAGAAAGGGCCAT
AAT
GGGACAATAGAGTTTACAAGTTTGGATGCACACAAAGGAGTGGCCCCGTCCAGGAGGAGTGATGTTG
AA
ATCCTTGGTTACTGCATGCTGCACTGGCTCTTCGGGAAGCTTCCTTGGGAAGCAAAGCTGGACGACCC
T
GTGGCTGTCCAGACTGCTAAAACCAACCTGCTGGATGAACTCCCAGAGTCGGTGCTTAAGTGGGCTCCT
TCT
GGAAGCAGTTGCAGTGAACTTGTCAAGTACTTGATGTATGTTCATAATTTAGCTTATGATGACAAGC
CA
GACTATCAGAAGCTCAAGAAAATTTTGAATCCAGATGGAGTACCTTTAGGGCCACTGGAATTTTCCAC
T
AAAGTACAGAGTGTCCATGTGCGGACTCCAGCCCAACAAAAAGTTGATTCACCAAAGGCTACAAGAAAA
CCA
GCCAATGAGTTCCCAGCTAAGTTCCCAAAGAAAGTCCACAGGGAGACAAGAGCAAGGCAGAGAGAGG
AG
CAGGAAGACAGCCAGCCCACAATGCTGCAGAGCAGGCCGGCAGCACCGGAAAACTCAAGGACAAGGAA
A
ATACATGAATATTCTGATATTTTCAGTGAGATGCAGAGTCTTCAACAAACACCCAGCTATATGAGTTTC
CAA
GGTTCATATTGCAAGCCCTATCTGGACTGCACTAGAAGAGATCCCATCAGGAAGCCAAGATCCCTGC
CT
CGGTACAGACACACGCCCACGGGTAATCTGGGAGTCACAGACTTGGAAAGTTCTCCAAGGTTTTGGCC
T
GCAATTTTTCAGTTGACTCTGAGTGAAGAGACAAAGGCAGATGTGTATTACTATGGGATCACTATATTC
TGT
CTGCTGATATTTGTATTTCTTGCTTTGTATTTTCTCTGA


Translation (503 aa):
MAPRRKEKYKLPVPLPEGKILDDMEGNRWALGKMIGSGGFGLIYLAFPTNKPNKDARHVIKLEYQENGPL
F
SELKFYQRAAKREC
IQKWIQQRKLDYLGIPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLDQNGGFKK
L
TVLQLGIRM
LDVLEYIHENEYVHGDIKAANLLLDFTNPDRVYLADYGLSYRYCPNGNHKQYQEDPRKGH
N
GTIEFTSLDAHKGV
APSRRSDVEILGYCMLHWLFGKLPWEAKLDDPVAVQTAKTNLLDELPESVLKWAP
S
GSSC
SELVKYLMYVHNLAYDDKPDYQKLKKILNPDGVPLGPLEFSTKVQSVHVRTPAQQKVDSPKATRK
P
ANEFPAKFPKKVHRETRARQREEQEDSQPTMLQSRPAAP
ENSRTRKIHEYSDIFSEMQSLQQTPSYMSF
Q
GSYCKPYLDCTRRDPIRKPRSLPRYRHTPTGNLGVTDLESSPRFWPAIFQLTLSEETKADVYYYGITIF
C
LLIFVFLALYFL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser