NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23360.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23360.1 Public Mus musculus 9 Dppa5a 21 106 86 CCDS HistoryNCBI Gene:434423Re-query CCDS DB by CCDS ID:23360.1Re-query CCDS DB by GeneID:434423See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23360.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000071991 ENSMUSP00000071881 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000071991Link to Ensembl Protein Viewer:ENSMUSP00000071881Re-query CCDS DB by Nucleotide ID:ENSMUST00000071991Re-query CCDS DB by Protein ID:ENSMUSP00000071881
Original member Current member EBI,WTSI OTTMUST00000047135 OTTMUSP00000021288 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000047135Link to Vega Protein Viewer:OTTMUSP00000021288Re-query CCDS DB by Nucleotide ID:OTTMUST00000047135Re-query CCDS DB by Protein ID:OTTMUSP00000021288
Original member Current member NCBI NM_025274.3 NP_079550.2 Accepted alive Link to Nucleotide Sequence:NM_025274.3Link to Protein Sequence:NP_079550.2Re-query CCDS DB by Nucleotide ID:NM_025274Re-query CCDS DB by Protein ID:NP_079550Link to BLAST:NP_079550.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079550.2 118 Q9CQS7 118 100% 0 0

Chromosomal Locations for CCDS 23360.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 78367236 78367294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78367721 78367903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 78367985 78368099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (357 nt):
ATGATGGTGACCCTCGTGACCCGTAAAGATATCCCCCCGTGGGTGAAAGTTCCTGAAGACCTGAAAGATC
CA
GAAGTATTCCAGGTCCAGTCGCTGGTGCTGAAATATCTGTTTGGCCCACAGGGATCTCGAATGTCTCA
C
ATCGAGCAGGTGAGCCAGGCCATGTTTGAGCTGAAGAACCTGGAATCTCCCGAAGAACTTATCGAGGTC
TTC
ATTTACGGCTCTCAAAACAACAAGATTCGGGCTAAATGGATGCTTCAGTCCATGGCTGAGAGGTACC
AC
CTGCGCCAGCAAAAAGGAGTGCTGAAGCTGGAGGAATCCATGAAGACCCTGGAGCTAGGCCAGTGTAT
C
GAGTGA


Translation (118 aa):
MMVTLVTRKDIPPWVKVPEDLKDPEVFQVQSLVLKYLFGPQGSRMSHIEQVSQAMFELKNLESPEELIEV
F
IYGSQNNKIRAKWMLQSMAERYHLRQQK
GVLKLEESMKTLELGQCIE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser