NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22812.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22812.2 Public Mus musculus 9 Birc3 21 106 86 CCDS HistoryNCBI Gene:11796Re-query CCDS DB by CCDS ID:22812.2Re-query CCDS DB by GeneID:11796See the combined annotation on chromosome 9 in Sequence Viewer

Public Note for CCDS 22812.1
The coding region has been updated to extend the N-terminus to one that is more supported by available conservation.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 22812.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000013949 ENSMUSP00000013949 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000013949Link to Ensembl Protein Viewer:ENSMUSP00000013949Re-query CCDS DB by Nucleotide ID:ENSMUST00000013949Re-query CCDS DB by Protein ID:ENSMUSP00000013949
Original member Current member EBI,WTSI OTTMUST00000048783 OTTMUSP00000022461 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000048783Link to Vega Protein Viewer:OTTMUSP00000022461Re-query CCDS DB by Nucleotide ID:OTTMUST00000048783Re-query CCDS DB by Protein ID:OTTMUSP00000022461
Original member Current member NCBI NM_007464.3 NP_031490.2 Accepted alive Link to Nucleotide Sequence:NM_007464.3Link to Protein Sequence:NP_031490.2Re-query CCDS DB by Nucleotide ID:NM_007464Re-query CCDS DB by Protein ID:NP_031490Link to BLAST:NP_031490.2

Chromosomal Locations for CCDS 22812.2

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 7849263 7849456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 7849672 7849713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 7850920 7851171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 7854367 7854606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 7857390 7857438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 7858701 7858779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 7860263 7860362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 7860463 7861315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1809 nt):
ATGAACATGGTTCAAGACAGCGCCTTTCTAGCCAAGCTGATGAAGAGTGCTGACACCTTTGAGTTGAAGT
AT
GACTTTTCCTGTGAGCTGTACCGATTGTCCACGTATTCAGCTTTTCCCAGGGGAGTTCCTGTGTCAGA
A
AGGAGTCTGGCTCGTGCTGGCTTTTACTACACTGGTGCCAATGACAAGGTCAAGTGCTTCTGCTGTGGC
CTG
ATGCTAGACAACTGGAAACAAGGGGACAGTCCCATGGAGAAGCACAGAAAGTTGTACCCCAGCTGCA
AC
TTTGTACAGACTTTGAATCCAGCCAACAGTCTGGAAGCTAGTCCTCGGCCTTCTCTTCCTTCCACGGC
G
ATGAGCACCATGCCTTTGAGCTTTGCAAGTTCTGAGAATACTGGCTATTTCAGTGGCTCTTACTCGAGC
TTT
CCCTCAGACCCTGTGAACTTCCGAGCAAATCAAGATTGTCCTGCTTTGAGCACAAGTCCCTACCACT
TT
GCAATGAACACAGAGAAGGCCAGATTACTCACCTATGAAACATGGCCATTGTCTTTTCTGTCACCAGC
A
AAGCTGGCCAAAGCAGGCTTCTACTACATAGGACCTGGAGATAGAGTGGCCTGCTTTGCGTGCGATGGG
AAA
CTGAGCAACTGGGAACGTAAGGATGATGCTATGTCAGAGCACCAGAGGCATTTCCCCAGCTGTCCGT
TC
TTAAAAGACTTGGGTCAGTCTGCTTCGAGATACACTGTCTCTAACCTGAGCATGCAGACACACGCAGC
C
CGTATTAGAACATTCTCTAACTGGCCTTCTAGTGCACTAGTTCATTCCCAGGAACTTGCAAGTGCGGGC
TTT
TATTATACAGGACACAGTGATGATGTCAAGTGTTTTTGCTGTGATGGTGGGCTGAGGTGCTGGGAAT
CT
GGAGATGACCCCTGGGTGGAACATGCCAAGTGGTTTCCAAGGTGTGAGTACTTGCTCAGAATCAAAGG
C
CAAGAATTTGTCAGCCAAGTTCAAGCTGGCTATCCTCATCTACTTGAGCAGCTATTATCTACGTCAGAC
TCC
CCAGAAGATGAGAATGCAGACGCAGCAATCGTGCATTTTGGCCCTGGAGAAAGTTCGGAAGATGTCG
TC
ATGATGAGCACGCCTGTGGTTAAAGCAGCCTTGGAAATGGGCTTCAGTAGGAGCCTGGTGAGACAGAC
G
GTTCAGTGGCAGATCCTGGCCACTGGTGAGAACTACAGGACCGTCAGTGACCTCGTTATAGGCTTACTC
GAT
GCAGAAGACGAGATGAGAGAGGAGCAGATGGAGCAGGCGGCCGAGGAGGAGGAGTCAGATGATCTAG
CA
CTAATCCGGAAGAACAAAATGGTGCTTTTCCAACATTTGACGTGTGTGACACCAATGCTGTATTGCCT
C
CTAAGTGCAAGGGCCATCACTGAACAGGAGTGCAATGCTGTGAAACAGAAACCACACACCTTACAAGCA
AGC
ACACTGATTGATACTGTGTTAGCAAAAGGAAACACTGCAGCAACCTCATTCAGAAACTCCCTTCGGG
AA
ATTGACCCTGCGTTATACAGAGATATATTTGTGCAACAGGACATTAGGAGTCTTCCCACAGATGACAT
T
GCAGCTCTACCAATGGAAGAACAGTTGCGGAAACTCCAGGAGGAAAGAATGTGTAAAGTGTGTATGGAC
CGA
GAGGTATCCATCGTGTTCATTCCCTGTGGCCATCTGGTCGTGTGCAAAGACTGCGCTCCCTCTCTGA
GG
AAGTGTCCCATCTGTAGAGGGACCATCAAGGGCACAGTGCGCACATTTCTCTCCTGA


Translation (602 aa):
MNMVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPRGVPVSERSLARAGFYYTGANDKVKCFCCG
L
MLDNWKQGDSPMEKHRKLYPSCNFVQTLNPANSLEASPRPSLPSTAMSTMPLSFASSENTGYFSGSYSS
F
PSDPVNFRANQDCPALSTSPYHFAMNTEKARLLTYETWPLSFLSPAKLAKAGFYYIGPGDRVACFACDG
K
LSNWERKDDAMSEHQRHFPSCPFLKDLGQSASRYTVSNLSMQTHAARIRTFSNWPSSALVHSQELASAG
F
YYT
GHSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLLRIKGQEFVSQVQAGYPHLLEQLLSTSD
S
PEDENADAA
IVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQWQILATGENYRTVSDLVIGLL
D
AEDEMREEQMEQAAEEEES
DDLALIRKNKMVLFQHLTCVTPMLYCLLSARAITEQECNAVKQKPHTLQA
S
TLIDTVLAKGNTAATSFRNSLREIDPALYRDIF
VQQDIRSLPTDDIAALPMEEQLRKLQEERMCKVCMD
R
EVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTFLS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser