NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21493.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21493.1 Public Mus musculus 7 Pold3 21 106 86 CCDS HistoryNCBI Gene:67967Re-query CCDS DB by CCDS ID:21493.1Re-query CCDS DB by GeneID:67967See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21493.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032969 ENSMUSP00000032969 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032969Link to Ensembl Protein Viewer:ENSMUSP00000032969Re-query CCDS DB by Nucleotide ID:ENSMUST00000032969Re-query CCDS DB by Protein ID:ENSMUSP00000032969
Original member Current member EBI,WTSI OTTMUST00000062244 OTTMUSP00000030660 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000062244Link to Vega Protein Viewer:OTTMUSP00000030660Re-query CCDS DB by Nucleotide ID:OTTMUST00000062244Re-query CCDS DB by Protein ID:OTTMUSP00000030660
Original member Current member NCBI NM_133692.2 NP_598453.1 Accepted alive Link to Nucleotide Sequence:NM_133692.2Link to Protein Sequence:NP_598453.1Re-query CCDS DB by Nucleotide ID:NM_133692Re-query CCDS DB by Protein ID:NP_598453Link to BLAST:NP_598453.1

Chromosomal Locations for CCDS 21493.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 100083652 100083854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100088064 100088142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100089652 100089755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100093372 100093481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100096373 100096535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100099464 100099536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100100420 100100681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100106563 100106695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100108512 100108551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100112270 100112372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100119674 100119729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 100121364 100121423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1386 nt):
ATGGCGGAACAGCTGTATCTAGAAAACATAGACGAGTTCGTCACGGACCAGAACAAGATCGTGACTTACA
AG
TGGCTAAGCTATACACTAGGGGTTCATGTTAACCAGGCCAAACAGATGCTCTATGAATATGTTGAAAG
G
AAACGGAAAGAAAATTCGGGAGCTCAGCTGCATGTTACCTACTTGGTGTCTGGCAGTCTTATACAGAAC
GGA
CATTCTTGCCACAAGGTTGCAGTAGTGAGAGAAGATAAACTGGAAGCAGTGAAGTCCAAGTTAGCTG
TG
ACTGCCAGCATCCATGTGTACAGCATCCAGAAAGCTATGCTAAAGGACAGTGGGCCTCTGTTCAATAC
C
GACTATGACATCCTTAAAAGCAATTTGCAGAACTGCAGCAAGTTTAGTGCCATACAGTGTGCAGCTGCA
GTC
CCCAGAGCTCCTGCAGAATCCCCATCTTCCAGAAAGTATGAACAGTCAAATCTTCAGGCAGCGAGTG
AG
GCACAAGCCAGTGAGCTGACTACCAATGGCCATGGTCCACCTGCCTCCAAACAGGCTTCCCAGCAGCC
C
AAAGGAATTATGGGAATGTTAATCTCTAAAGCTGCTACTAAAACCCAGGACACCAACAAGGAAACCAAA
CCA
GAGGCCCGAGAAGTAACCAGTGCATCTTCTGCTGGGGGCAAAGCACCAGGAAAAGGGAGTGTGATGA
GC
AACTTTTTTGGAAAAGCTGCAATGAATAAACTTAAAGTCAATTTGGATTCAGAACAAGCAGTAAAGGA
A
GAAAAAACAGTGGAGCAACCTCCAGTGTCTGTCACTGAACCAAAGCTGGCAGCTCCCCCAGCTCAGAAG
AAA
TCCAGCAGAAAGTCCGAGCCTGGGAAGGTGCAGCAGAAGGAGAAAAGCAGGGGCAAGCGAGTAGACT
TG
TCGGATGAGGAGGCAAAGGAAACCGAACACCTGAAGAAAAAGAGAAGAAGAATCAAGCTTCCTCAGTC
T
GATAGCAGTGAAGATGAAGTCTTCGAAGACTCCCCTGAGATGTATGAAGCAGACTCACCATCTCCACCT
CCT
GTATCTCCACCTCCTGATCCTATGCCAAAAACTGAGCCCCCTCCTGTCAAGCGTTCAAGTGGAGAAA
CC
AAAAGGAGACGAAAGCGTGTACTGAAATCTAAAACCTTTGTGGATGAAGAAGGCTGCATAGTGACTGA
G
AAAGTCTATGAGAGTGAGTCCTGCACAGACAGTGAGGAGGAGCTTAAGATGAAGCCGGCCTCAGCACAC
AAA
CCCCCTGCTGCCGCTGTGAAAAGGGAGCCCAGAGAAGAACGGAAGGGCCCCAAGAAAGGGGCTGCTG
CT
CTGGGCAAAGCCAACAGACAAGTGTCCATTACTGGCTTCTTCCAGAAAAAGTAA


Translation (461 aa):
MAEQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYEYVERKRKENSGAQLHVTYLVSGSLIQN
G
HS
CHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAA
V
PRAPAESPSSRKYEQSNLQAASEAQASELTTNGHGPPASKQASQQPKGIMGMLISKAATKTQDTNKETK
P
EAREVTS
ASSAGGKAPGKGSVMSNFFGKAAMNKLKVNLDSEQAVKEEKTVEQPPVSVTEPKLAAPPAQK
K
SSRKSEPGKVQQKEK
SRGKRVDLSDEEAKETEHLKKKRRRIKLPQSDSSEDEVFEDSPEMYEADSPSPP
P
VSPPPDPMPKTEPPPVK
RSSGETKRRRKRVLKSKTFVDEEGCIVTEKVYESESCTDSEEELKMKPASAH
K
PPAAAVKREPREERKGPKKGAAALGKANRQVSITGFFQKK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser