NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19702.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19702.1 Public Mus musculus 5 Chchd2 21 106 86 CCDS HistoryNCBI Gene:14004Re-query CCDS DB by CCDS ID:19702.1Re-query CCDS DB by GeneID:14004See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 19702.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000094280 ENSMUSP00000091835 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000094280Link to Ensembl Protein Viewer:ENSMUSP00000091835Re-query CCDS DB by Nucleotide ID:ENSMUST00000094280Re-query CCDS DB by Protein ID:ENSMUSP00000091835
Original member Current member EBI,WTSI OTTMUST00000058725 OTTMUSP00000028489 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000058725Link to Vega Protein Viewer:OTTMUSP00000028489Re-query CCDS DB by Nucleotide ID:OTTMUST00000058725Re-query CCDS DB by Protein ID:OTTMUSP00000028489
Original member Current member NCBI NM_024166.6 NP_077128.2 Accepted alive Link to Nucleotide Sequence:NM_024166.6Link to Protein Sequence:NP_077128.2Re-query CCDS DB by Nucleotide ID:NM_024166Re-query CCDS DB by Protein ID:NP_077128Link to BLAST:NP_077128.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077128.2 153 Q9D1L0 153 100% 0 0

Chromosomal Locations for CCDS 19702.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 129881386 129881396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 129882429 129882579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 129883934 129884183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 129887198 129887247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (462 nt):
ATGCCGCGTGGAAGCCGAAGCCGCACTTCCCGGGTGACTCCTCCGGCCAGCCGGGCCCCTCAGATGAGGG
CT
GCTCCCCGAAGAGCACCTGCAGCTCAGCCTCCAGCAGCAGCTGCGCCATCTGCAGTTGGCTCACCTGC
C
GCTGCGCCCCGGCAGCCAGGCCTGATGGCCCAGATGGCTACCACCGCGGCCGGTGTGGCTGTGGGCTCT
GCA
GTGGGACACACCCTGGGTCACGCCATCACTGGGGGCTTCAGCGGAGGTGGCAGTGCTGAGCCCGCAA
AG
CCCGACATCACTTACCAGGAGCCTCAGGGAGCCCAGCTGCAGAACCAGCAGTCTTTTGGACCTTGCTC
T
CTAGAGATCAAGCAGTTTCTGGAGTGTGCTCAGAACCAGAGCGATGTCAAGCTCTGTGAGGGCTTCAAC
GAG
GTGCTGCGGCAGTGCAGGATTGCAAATGGTTTAATGTAA


Translation (153 aa):
MPRGSRSRTSRVTPPASRAPQMRAAPRRAPAAQPPAAAAPSAVGSPAAAPRQPGLMAQMATTAAGVAVGS
A
VGHTLGHAITGGFSGGGSAEPAKPDITYQ
EPQGAQLQNQQSFGPCSLEIKQFLECAQNQSDVKLCEGFN
E
VLRQCRIAN
GLM



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser