NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19087.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19087.1 Public Mus musculus 5 Crot 21 106 86 CCDS HistoryNCBI Gene:74114Re-query CCDS DB by CCDS ID:19087.1Re-query CCDS DB by GeneID:74114See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 19087.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000003720 ENSMUSP00000003720 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003720Link to Ensembl Protein Viewer:ENSMUSP00000003720Re-query CCDS DB by Nucleotide ID:ENSMUST00000003720Re-query CCDS DB by Protein ID:ENSMUSP00000003720
Original member Current member EBI,WTSI OTTMUST00000059513 OTTMUSP00000028948 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059513Link to Vega Protein Viewer:OTTMUSP00000028948Re-query CCDS DB by Nucleotide ID:OTTMUST00000059513Re-query CCDS DB by Protein ID:OTTMUSP00000028948
Original member Current member NCBI NM_023733.3 NP_076222.1 Accepted alive Link to Nucleotide Sequence:NM_023733.3Link to Protein Sequence:NP_076222.1Re-query CCDS DB by Nucleotide ID:NM_023733Re-query CCDS DB by Protein ID:NP_076222Link to BLAST:NP_076222.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_076222.1 612 Q9DC50 612 100% 0 0

Chromosomal Locations for CCDS 19087.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 8966852 8966972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8968647 8968766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8968870 8968963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8969048 8969126 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8969916 8970039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8973586 8973716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8973945 8974052 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8974133 8974216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8976008 8976109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8977455 8977580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8978198 8978291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8983689 8983797 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8987768 8987892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8988104 8988285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8989606 8989730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 8993506 8993620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1839 nt):
ATGGAAAATCAATTGACTAAATCAGTTGAAGAACGGACATTTCAGTACCAGGACTCTCTTCCGTCATTGC
CT
GTTCCTGCACTTGAAGAATCATTAAAAAAATACCTTGAATCAGTGAAACCATTCGCAAATGAAGACGA
G
TATAAGAAAACTGAAGAAATAGTTCAAAAGTTTCAAGAAGGAGCTGGCAAAAGATTGCATCAGAAGTTA
CTT
GAAAGGGCTAGAGGAAAACGAAACTGGCTGGAAGAATGGTGGCTCAATGTTGCCTACCTGGACGTAC
GT
ATTCCATCACAACTGAATGTGAACTTTGTGGGTCCGTGTCCTCATTTTGAGCACTACTGGCCTGCAAG
G
GAAGGCACTCAGTTAGAAAGAGGAAGCATGATGCTGTGGCACAACTTGAACTACTGGCAGCTGCTAAGA
AG
A
GAAAAATTGCCTGTACATAAATCTGGAAATACTCCTCTAGACATGAACCAATTCCGAATGTTGTTTT
CT
ACCTGCAAGGTTCCAGGAATTACTAGAGATTCGATTATGAATTATTTTAAGACTGAGAGTGAAGGGCA
T
TGTCCAACCCACATTGCCGTGCTGTGTCGAGGCAGAGCGTTTGTCTTTGATGTACTACATGAGGGATGT
TTG
ATCACCCCACCAGAACTTCTCAGACAATTGACATATATCCACAAGAAGTGCTCGAACGAACCTGTTG
GA
CCCAGTATAGCGGCATTAACTAGCGAGGAGCGAACTCGGTGGGCAAAGGCAAGAGAATATCTGATTAG
T
CTTGATCCAGAGAACTTGACTTTATTAGAAAAAATTCAAACCAGTTTATTTGTGTATTCCATAGAAGAT
AGC
AGTCCACATGCAACCCCAGAAGAATATTCTCAGGTCTTTGAAATGCTTCTTGGTGGAGATCCATCAG
TA
CGCTGGGGTGACAAGTCCTATAATTTGATTTCCTTTGCTAATGGAATATTTGGCTGTTGCTGTGATCA
T
GCTCCTTACGATGCAATGGTCATGGTGAACATTGCACATTATGTTGATGAGAGAGTCCTAGAGACAGAA
GGA
AGATGGAAGGGTTCAGAAAAAGTCCGGGACATACCATTGCCAGAGGAGCTGGTCTTCACTGTGGATG
AG
AAAATACTGAATGATGTATCCCAAGCCAAAGCCCAACATCTCAAAGCTGCGTCAGATCTGCAGATAGC
A
GCATCTACCTTCACATCTTTTGGCAAAAAGCTCACCAAGGAGGAAGCCCTTCACCCTGATACCTTTATT
CAG
CTCGCTCTTCAGCTTGCCTACTACAGACTTCATGGACGCCCTGGTTGCTGCTATGAGACAGCTATGA
CA
AGATACTTTTACCACGGCCGAACAGAGACTGTGCGATCTTGTACAGTGGAGGCCGTCAGGTGGTGCCA
G
TCCATGCAGGATCCCTCTGCTAGTCTCCTTGAACGTCAGCAAAAGATGCTAGAAGCTTTTGCCAAGCAT
AAT
AAGATGATGAAAGATTGTTCACATGGAAAAGGATTTGACCGTCACCTTTTAGGTCTTTTGCTCATAG
CA
AAAGAGGAAGGTCTCCCTGTTCCAGAACTATTTGAGGACCCACTTTTCTCCAGAAGTGGAGGAGGTGG
A
AATTTTGTGCTCTCAACAAGTTTGGTTGGTTACTTACGAGTTCAGGGTGTTGTGGTTCCCATGGTACAC
AAT
GGATATGGATTTTTCTACCACATCAGAGATGACAGGTTTGTGGTGGCATGTTCATCCTGGAGGTCAT
GT
CCGGAGACTGATGCTGAAAAGCTTGTTCAGATGATTTTTCATGCTTTCCACGATATGATACAGCTGAT
G
AACACCGCTCATCTTTAG


Translation (612 aa):
MENQLTKSVEERTFQYQDSLPSLPVPALEESLKKYLESVKPFANEDEYKKTEEIVQKFQEGAGKRLHQKL
L
ERARGKRNW
LEEWWLNVAYLDVRIPSQLNVNFVGPCPHFEHYWPAREGTQLERGSMMLWHNLNYWQLLR
R
EKLPVHKSGNTPLDMNQFRMLFSTCKVPGITRDSIMNYFKTESEGHCPTHIAVLCRGRAFVFDVLHEGC
L
ITPPELL
RQLTYIHKKCSNEPVGPSIAALTSEERTRWAKAREYLISLDPENLTLLEKIQTSLFVYSIED
S
SPHATPEEYSQ
VFEMLLGGDPSVRWGDKSYNLISFANGIFGCCCDHAPYDAMVMVNIAHYVDERVLETE
G
RWK
GSEKVRDIPLPEELVFTVDEKILNDVSQAKAQHLKAASDLQIAASTFTSFGKKLTKEEALHPDTFI
Q
LALQLAYYRLHG
RPGCCYETAMTRYFYHGRTETVRSCTVEAVRWCQSMQDPSASLLERQQKMLEAFAKH
N
KMMKDCSHGK
GFDRHLLGLLLIAKEEGLPVPELFEDPLFSRSGGGGNFVLSTSLVGYLRVQGVVVPMVH
N
GYGFFYHIRDD
RFVVACSSWRSCPETDAEKLVQMIFHAFHDMIQLMNTAHL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser