NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18872.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18872.1 Public Mus musculus 4 Clcnkb 21 106 86 CCDS HistoryNCBI Gene:56365Re-query CCDS DB by CCDS ID:18872.1Re-query CCDS DB by GeneID:56365See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18872.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000006378 ENSMUSP00000006378 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000006378Link to Ensembl Protein Viewer:ENSMUSP00000006378Re-query CCDS DB by Nucleotide ID:ENSMUST00000006378Re-query CCDS DB by Protein ID:ENSMUSP00000006378
Original member Current member EBI,WTSI OTTMUST00000023973 OTTMUSP00000010991 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000023973Link to Vega Protein Viewer:OTTMUSP00000010991Re-query CCDS DB by Nucleotide ID:OTTMUST00000023973Re-query CCDS DB by Protein ID:OTTMUSP00000010991
Original member Current member NCBI NM_019701.2 NP_062675.2 Accepted alive Link to Nucleotide Sequence:NM_019701.2Link to Protein Sequence:NP_062675.2Re-query CCDS DB by Nucleotide ID:NM_019701Re-query CCDS DB by Protein ID:NP_062675Link to BLAST:NP_062675.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062675.2 687 Q9WUB6-1 687 100% 0 0

Chromosomal Locations for CCDS 18872.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 141404585 141404632 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141404753 141404839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141405052 141405135 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141405272 141405360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141407089 141407222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141407804 141408017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141408306 141408416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141408576 141408645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141409326 141409499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141409742 141409826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141410516 141410617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141410694 141410778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141411383 141411508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141411590 141411668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141411743 141411820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141412192 141412331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141413885 141414013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141414445 141414573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 141415196 141415295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2064 nt):
ATGGAGGAATTAGTGGGGCTTCGTGAGGGCGCCTCCAAGAAGCCAGTGCCACTGCAAGAACTCTGGGGGC
CA
TGCCCACGCATCCGCAGAAACATCCAGGGGGGCCTAGAGTGGCTGAAAGAGCGGCTCTTCCGTGTGGG
T
GAGGACTGGTACTTCCTGGTGGCTCTCGGGGTGCTCATGGCTCTGATCAGCTATGCTATGAACTTCACT
ATT
GGGCGCGTGGTCAGAGCACACAAGTGGCTGTACAGGGAGATTGGAGATGGCCACCTGCTCCGGTACC
TC
TCCTGGACCGTGTACCCCGTGGCTCTTCTGTCCTTCTCCTCCGGCTTCTCACAGAGCATCACACCATC
C
TCTGGAGGGTCTGGAATCCCTGAGGTGAAGACCATCTTGACCGGAGTGGTCCTGGAGGACTACCTAGAC
ATC
AAGAACTTCGGGGCCAAGGTGGTGGGCCTCTCCTGCACCCTGGCCACAGGCAGTACCATCTTCCTGG
GA
AAATTGGGTCCCTTCGTGCACCTGAGCGTGATGATCGCTGCTTACCTGGGCCGCGTGCGCACCAAGAC
C
GTCGGGGAACCTGAGAGCAAGACCAAAGAAATGGAACTGTTGGCCGCAGGAGCAGCAGTGGGTGTGGCC
ACG
GTCTTCGCAGCTCCCATCAGCGGTGTCCTGTTCAGCATCGAGGTCATGTCCTCTCACTTCTCCGTCT
GG
GATTACTGGAGGGGCTTCTTCGCTGCCACCTGTGGGGCCTTTATGTTCCACCTCCTGGCAGTCTTCAA
C
AATGAACAGGAGACCATCACCTCCATCTACAAGACCAGCTTTCCAGTGGACATACCCTTTGACTTACCA
GAG
ATCTTCTTTTTTGTGGCCCTGGGGGCCATCTGTGGCATCCTGAGCTGCGGGTACAACTACAGCCAGC
GG
ACTTTCTTATTTTTCCTCAAGGCCAATGGGTTCACCTCCAAACTGCTGGCTACCAGCAAACCCTTGTA
C
TCAGCCCTGGCTGCTGTGGTCCTGGCTTCCATCACGTATCCCCCTGGTGTGGGCCACTTCATGGCTTCC
CGG
CTGTCCATGTCGGAGCATTTGGAGACACTGTTTGACAACAACTCCTGGGCACTGATGACTAAGAACT
CG
TCTCCACCCTGGGCAGCGGAGCCTGATCCCCAGAAGCTGTGGTTGGAGTGGTGTCACCCACAGTTGAC
T
GTCTTTGGGACACTAGTCTTCTTCCTGGTCATGAAGTTCTGGATGCTGATTTTGGCAACCACCATCCCC
ATC
CCTGCTGGATACTTCTTGCCCATCTTTATCTATGGAGCTGTCATTGGGCGCCTCTTTGGGGAGGTTC
TA
TCTGTCGCCTTCCCAGAGGGCATTGTGGCTGGAGGCAGGGTCAATCCCATCATGCCCGGGGCCTATGC
T
CTGGCAGGTGCTGCTGCCTTCTCAGGGGCGGTGACCCACACCCTCTCCACGGCACTGCTGGCCTTTGAG
GTA
ACGGGCCAGCTCGTTCACGCACTGCCTGTGCTGATGGCTGTGCTGGCGGCCAACGCCATCTCTCAGA
GC
TTCCAGCCCTCTTTCTACGATGGCACCATCATTGTCAAGAAACTGCCGTACCTGCCGTGGATCCGTGG
C
CGACAGATTGGTTCCCACTCTGTAACTGTGGGTCACTTCATGAACTGCGCCCTCACTACACTGGCCAAG
GAC
ATGCCCCTGGAGCAAGTGATCCAAGTCGTGATCTCCACAGATGTGACCCAGTACCCCCTGGTGGAGA
CT
ACAGAGTCTCAGACCCTGGTGGGCGTTGTAAAAAGGACCCACTTGGTGCAAGCCCTCCAGACTGAGCC
A
GCTTCCTGGGCTCCAGGCCAGCAGCCCTGTCTCCAGGATATCTTGGCTAATGGCTGCCCCACCCAGCCA
GTG
ACACTGCAGCTGTCCCTGGAGACCTCCTTGCATGAGACACACAACCTTTTTGAGCTGCTGAACCTTC
AG
ACGCTGTTCGTGACGTCACGAGGCAGAGCTGTGGGCTCTGTATCGTGGGTGGAGCTGAAGAAAGCAAT
T
TCAACCCTGACCAATCCTCCTGCCCCCAAGTGA


Translation (687 aa):
MEELVGLREGASKKPVPLQELWGPCPRIRRNIQGGLEWLKERLFRVGEDWYFLVALGVLMALISYAMNFT
I
GRVVR
AHKWLYREIGDGHLLRYLSWTVYPVALLSFSSGFSQSITPSSGGSGIPEVKTILTGVVLEDYLD
I
KNFGAKVVGLSCTLATGSTIFLGKL
GPFVHLSVMIAAYLGRVRTKTVGEPESKTKEMELLAAGAAVGVA
T
VFAAPIS
GVLFSIEVMSSHFSVWDYWRGFFAATCGAFMFHLLAVFNNEQETITSIYKTSFPVDIPFDLP
E
IFFFVAL
GAICGILSCGYNYSQRTFLFFLKANGFTSKLLATSKPLYSALAAVVLASITYPPGVGHFMAS
R
LSMSEHLETLFDNNSWALMTKNSSPPWAAEPDPQKLWLEWCHPQLTVFGTLVFFLVMKFWMLILATTIP
I
PAGYFLPIFIY
GAVIGRLFGEVLSVAFPEGIVAGGRVNPIMPGAYALAGAAAFSGAVTHTLSTALLAFE
V
TGQLVHALPVLMAVLAANAISQSFQPSFYDGTIIVKKLPYLPWIRGRQI
GSHSVTVGHFMNCALTTLAK
D
MPLEQVIQVVISTDVTQYPLVETT
ESQTLVGVVKRTHLVQALQTEPASWAPGQQPCLQDILANGCPTQP
V
TLQLSLETSLHE
THNLFELLNLQTLFVTSRGRAVGSVSWVELKKAISTLTNPPAPK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser