NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17933.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17933.1 Public Mus musculus 3 Ankrd13c 21 106 86 CCDS HistoryNCBI Gene:433667Re-query CCDS DB by CCDS ID:17933.1Re-query CCDS DB by GeneID:433667See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17933.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000040787 ENSMUSP00000038662 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040787Link to Ensembl Protein Viewer:ENSMUSP00000038662Re-query CCDS DB by Nucleotide ID:ENSMUST00000040787Re-query CCDS DB by Protein ID:ENSMUSP00000038662
Original member Current member EBI,WTSI ENSMUST00000164582 ENSMUSP00000125831 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164582Link to Ensembl Protein Viewer:ENSMUSP00000125831Re-query CCDS DB by Nucleotide ID:ENSMUST00000164582Re-query CCDS DB by Protein ID:ENSMUSP00000125831
Original member Current member EBI,WTSI OTTMUST00000131905 OTTMUSP00000070436 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000131905Link to Vega Protein Viewer:OTTMUSP00000070436Re-query CCDS DB by Nucleotide ID:OTTMUST00000131905Re-query CCDS DB by Protein ID:OTTMUSP00000070436
Original member NCBI NM_001013806.1 NP_001013828.1 Updated not alive Link to Nucleotide Sequence:NM_001013806.1Link to Protein Sequence:NP_001013828.1Re-query CCDS DB by Nucleotide ID:NM_001013806Re-query CCDS DB by Protein ID:NP_001013828
Current member NCBI NM_001013806.2 NP_001013828.1 Accepted alive Link to Nucleotide Sequence:NM_001013806.2Link to Protein Sequence:NP_001013828.1Re-query CCDS DB by Nucleotide ID:NM_001013806Re-query CCDS DB by Protein ID:NP_001013828Link to BLAST:NP_001013828.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001013828.1 541 Q3UX43-1 541 100% 0 0

Chromosomal Locations for CCDS 17933.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 157947527 157947956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 157960984 157961025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 157962278 157962382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 157972232 157972317 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 157973000 157973045 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 157975228 157975294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 157988640 157988784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 157991681 157991812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 157994597 157994758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 157999657 157999736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 158001074 158001172 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 158003709 158003809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 158005740 158005870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1626 nt):
ATGACCGGGGAGAAGATCCGCTCCCTGCGGAGGGACCACAAGCCCAGCAAAGAGGACGGGGACGTGCTGG
AG
CCCTGCGAGGAGGAGGCGACAGCCGCGCTCGGCGGCGCCTTCACCGGGGGCAGAAGCGGACCGGGCGG
C
AGCGGCAAGGGCGGCAAGGCCTGCCATAAGATCTTCAGCCACCACCACCGGCTGCAGCTGAAGGCGCCC
GCC
GTTCCGGGCCCCGGCGTTCCGGCCCCGCCGCAGCACAACGCAGTGACTGCCACCTGCCCTGCCCCGG
CC
TGCCTGGGCGGCAGCAACCCCGCTTTAGTCGCTGACGGAGGCGGCTGCCCCTCGCTCTACCCGGTCCA
C
GAGTGCGTCTTTAAGGGGGACGTGAGGAGACTGTCCTCGCTCATCCGCACGCACAATATCGGACAGAAA
GAT
AATCATGGAAACACTCCTTTACATCTTGCTGTGATGTTAGGAAATAAAGAATGCGCACATTTACTGT
TG
GCTCATAATGCTCCAGTAAAGGTGAAAAATGCTCAGGGATGGAGCCCTCTTGCGGAAGCCATCAGCTA
T
GGAGACAGACAGATGATCACAGCTCTTCTAAGGAAACTCAAGCAGCAATCTAGGGAGAGTGTTGGAGAA
AAA
CGACCTAGGTTGTTAAAAGCCCTAAAAGAGTTAGGTGACTTTTACCTAGAACTTCACTGGGATTTTC
AA
AGCTGGGTGCCTTTGCTTTCCCGAATTCTGCCTTCTGATGCCTGTAAAATATACAAGCAAGGTATCAA
C
ATCAGGCTTGACACAACTCTCATAGACTTTACTGACATGAAGTGCCAACGAGGGGATCTAAGCTTCATC
TTC
AATGGGGATGCTGCACCCTCTGAGTCTTTTGTAGTGTTAGACAATGAACAAAAAGTTTATCAGCGAA
TA
CACCATGAGGAGTCAGAGATGGAAACAGAAGAAGAAGTTGATATTTTAATGAGCAGTGATATTTATTC
T
GCAACTTTATCAACCAAATCCATTTCTTTCACACGTGCCCAAACTGGATGGCTTTTTCGGGAAGATAAA
ACA
GAAAGAGTAGGAAACTTTTTGGCAGACTTTTATCTGGTGAATGGACTTGTTCTAGAATCAAGGAAAA
GG
AGGGAGCACCTGAGTGAGGAGGACATCCTGCGGAACAAGGCCATCATGGAGAGCCTGAGCAAAGGGGG
G
AGCCTGGCGGAGCAGAGCTTTGAGCCGGTTAGAAGACAGTCCCTTACCCCTCCTCCTCAGAACACTATT
ACG
TGGGAAGAATACATATCCGCTGAAAATGGAAAGGCACCACACCTGGGCAGAGAACTGGTGTGCAAAG
AG
AGCAAGAAAACATTTAAAGCCACTGTAGCCATGAGCCAGGAATTTCCCCTGGGAATTGAGTCATTGTT
G
AATGTTCTAGAAGTAATAGCACCCTTCAAGCACTTTAACAAGCTTAGAGAATTCGTTCAAATGAAGCTT
CCT
CCAGGCTTTCCTGTAAAATTAGATATACCCGTGTTTCCCACAATCACAGCCACTGTGACTTTTCAGG
AG
TTCCGATGTGATGAATTTGATGGATCCATCTTTGCTATCCCTGAAGACTACAAGGAAGACCCAAGTCG
T
TTTCCTGACCTTTAA


Translation (541 aa):
MTGEKIRSLRRDHKPSKEDGDVLEPCEEEATAALGGAFTGGRSGPGGSGKGGKACHKIFSHHHRLQLKAP
A
VPGPGVPAPPQHNAVTATCPAPACLGGSNPALVADGGGCPSLYPVHECVFKGDVRRLSSLIRTHNIGQK
D
NH
GNTPLHLAVMLGNKECAHLLLAHNAPVKVKNAQGWSPLAEAISYGDRQMITALLRKLKQQSRESVGE
K
RPRLLKALKE
LGDFYLELHWDFQSWVPLLSRILPSDACKIYKQGINIRLDTTLIDFTDMKCQRGDLSFI
F
NGDAAPSESFVVLDNEQKVYQRIHHE
ESEMETEEEVDILMSSDIYSATLSTKSISFTRAQTGWLFREDK
T
ERVGNFLADFYLVNGLVLESRKRREHLSEEDILRNKAIMESLSKGGSLAEQSFEPVRRQSLTPPPQNTI
T
WEEYISAENG
KAPHLGRELVCKESKKTFKATVAMSQEFPLGIESLLNVLEVIAPFKHFNKLREFVQMKL
P
PGFPVKL
DIPVFPTITATVTFQEFRCDEFDGSIFAIPEDYKEDPSRFPDL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser