NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17807.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17807.1 Public Mus musculus 3 Arhgap29 21 106 86 CCDS HistoryNCBI Gene:214137Re-query CCDS DB by CCDS ID:17807.1Re-query CCDS DB by GeneID:214137See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17807.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000037958 ENSMUSP00000044624 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000037958Link to Ensembl Protein Viewer:ENSMUSP00000044624Re-query CCDS DB by Nucleotide ID:ENSMUST00000037958Re-query CCDS DB by Protein ID:ENSMUSP00000044624
Original member Current member EBI,WTSI OTTMUST00000065825 OTTMUSP00000032859 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065825Link to Vega Protein Viewer:OTTMUSP00000032859Re-query CCDS DB by Nucleotide ID:OTTMUST00000065825Re-query CCDS DB by Protein ID:OTTMUSP00000032859
Original member NCBI NM_172525.2 NP_766113.1 Updated not alive Link to Nucleotide Sequence:NM_172525.2Link to Protein Sequence:NP_766113.1Re-query CCDS DB by Nucleotide ID:NM_172525Re-query CCDS DB by Protein ID:NP_766113
Current member NCBI NM_172525.3 NP_766113.1 Accepted alive Link to Nucleotide Sequence:NM_172525.3Link to Protein Sequence:NP_766113.1Re-query CCDS DB by Nucleotide ID:NM_172525Re-query CCDS DB by Protein ID:NP_766113Link to BLAST:NP_766113.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766113.1 1266 Q8CGF1-1 1266 100% 0 0

Chromosomal Locations for CCDS 17807.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 121973911 121974115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121981815 121981949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121988489 121988585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121988912 121988984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121990309 121990357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121990985 121991122 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121991862 121991926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121992334 121992444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121992533 121992613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121992742 121992930 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 121993580 121993717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122002542 122002702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122003209 122003348 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122004245 122004349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122005655 122005753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122006776 122006915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122007544 122007732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122007954 122008091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122009826 122010058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122011250 122011580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122012065 122012173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 122014101 122014975 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3801 nt):
ATGATTGCTCACAAACAGAAAAAGGCAAAGAAAAAGCGTGTTTGGGCATCAGGCCAACCTTCTGCTGCTA
TT
ACAACTTCTGAAATGGGGCTCAAGTCCGTAAGTTCCAGCTCCAGTTTTGATCCGGAGTACATCAAGGA
G
CTGGTGAATGATGTCAGGAAGTTCTCCCATATGTTGCTATATTTGAAAGAAGCTATTCTTTCAGACTGT
TTT
AAAGAAGTCATTCATATCCGTCTGGATGAGCTTCTCCGTGTTTTAAAGTCGATATTGAGCAAGCATC
AG
AACCTCAGCTCCGTAGATCTTCAGAGCGCTGCAGAGGTGCTCACTGCAAAAGTGAAAGCTGTGAACTT
T
ACAGAAGTTAATGAAGAAAACAAAAACGATATATTCCGAGAAGTCTTTTCCTCCATTGAAACATTGGCA
TTT
ACCTTTGGAAACATCCTCACAAACTTCCTTATGGGAGACGTAGGCAGTGACTCGATACTACGTCTAC
CT
ATTTCTCGAGAAAGTAAGTCTTTTGAAAACATTTCTGTGGACTCAGTGGACTTACCCCATGAAAAAGG
A
AATTTTTCTCCTATAGAACTAGACAACTTGCTGTTAAAGAACACTGACTCTATAGAGCTGGCTTTGTCC
TAT
GCTAAAACATGGTCAAAATATACCAAGAATATAGTGTCGTGGGTTGAAAAAAAGCTCAACTTGGAAT
TG
GAGTCCACTAGAAATATTGTAAAATTGGCAGAGGCAACTAGATCTAGCATTGGTATACAAGAGTTTAT
G
CCACTGCAGTCTCTATTTACCAACGCTCTTCTCAGTGACATCCACAGCAGCCACCTTCTACAACAGACA
ATT
GCAGCCCTCCAAGCCAATAAATTTGTGCAGCCTCTACTTGGGAGGAAGAATGAGATGGAGAAGCAAA
GG
AAAGAAATAAAAGACCTTTGGAAGCAGCAACAGAATAAATTGCTCGAAACAGAGACAGCTCTCAAAAA
A
GCAAAATTGTTGTGCATGCAGCGGCAAGATGAATACGAAAAGGCAAAATCGTCCATGTTTCGTGCAGAA
GAA
GAGCAGCTAAGTTCAAGTGTTGGTTTGGCAAAAAATCTCAACAAACAACTGGAAAAAAGGCGGAGGT
TG
GAAGAAGAGGCTCTTCAAAAAGTAGAAGAAGCAAACGAACACTACAAAGTCTGTGTAACAAATGTTGA
A
GAAAGACGGAATGATCTAGAAAATACAAAGAGGGAAATTTTAACACAGCTTCGGACACTTGTTTTCCAG
TGT
GACCTTACACTTAAAGCTGTAACAGTTAACCTCTTTCATATGCAGCAGCTACAGGCTGCATCCCTTG
CC
AACAGTTTACAGTCCCTCTGTGACAGTGCCAAACTCTATGATCCAGGTCAGGAGTACAGTGAATTCGT
G
AAGGCTACAAGCTCAAGTGAATTAGAAGAAAAGGTTGATGGGAATGTAAATAAACAAATGACCAACAGT
CCG
CAGACATCTGGCTATGAACCTGCTGACTCCTTAGAGGATGTTGCCCGCCTTCCTGACAGCTGTCATA
AG
CTTGAAGAGGACAGGTGCTCCAACAGTGCAGACATGACAGGTCCTTCTTTCGTAAGATCATGGAAGTT
C
GGAATGTTTAGTGACTCAGAGAGCACTGGAGGAAGCAGTGAGTCTAGATCTCTGGATTCAGAGTCTATA
AGT
CCAGGAGACTTTCATCGGAAACTTCCACGGACTCCATCCAGTGGAACCATGTCTTCTGCTGATGATC
TC
GATGAGAGAGAGCCACCGTCCCCTTCAGAAGCTGGACCCAATTCCCTCGGAGCATTTAAGAAAACTTT
G
ATGTCAAAGGCAGCTCTCACTCACAAGTTTCGCAAGTTGAGATCCCCGACAAAGTGCAGGGATTGTGAC
GGC
ATCGTAATGTTCCCAGGCGTCGAGTGTGAAGAGTGTCTCCTTGTTTGTCATCGGAAGTGTCTGGAGA
AT
TTAGTCATTATTTGTGGTCATCAAAAACTTCAGGGAAAAATGCACATATTTGGAGCAGAATTCATACA
A
GTTGCAAAAAAGGAACCAGATGGCATCCCTTTTGTACTGAAAATATGTGCCTCAGAAATTGAAAATAGA
GCC
TTGTGTCTCCAGGGAATTTATCGTGTTTGTGGAAACAAAATAAAAACTGAAAAACTGTGCCAAGCTT
TG
GAAAATGGGATGCACTTAGTAGACATTTCAGAATTCAGTTCACATGACATCTGTGATGTCTTGAAATT
A
TACCTGCGACAGCTTCCAGAACCATTTATTTTATTCAGATTGTACAAGGAATTTATAGACCTTGCAAAA
GAG
ATACAACATGTAAATGAAGAACAAGAGGCAAAAAAAGATAGCCCTGAAGACAAGAAACACCCACATG
TG
AGCATAGAAGTCAACCGCATCCTTCTGAAGAGCAAAGACCTGCTGAGACAGCTGCCAGCGTCACATTT
C
AACAGCCTCCATTACCTCATAGCACATCTGAGGCGAGTGGTGGATCATGCAGAAGAGAACAAGATGAAT
TCT
AAGAACTTGGGGGTGATATTTGGACCAACTCTCATTAGGCCAAGGCCTACAACGGCTCCTGTCACCA
TC
TCGTCCCTTGCTGAATATTCCAATCAGGCACGATTAGTAGAGTTCCTTATTACTTACTCACAGAAGAT
C
TTCGATGGGTCCCTCCAGCCTCAAGCTGTTGTTATATCTAACACAGGTGCTGTGGCACCTCAGGTTGAT
CAA
GGCTATCTTCCAAAACCTCTGTTATCACCAGATGAGAGAGACACAGATCATTCTATGAAACCACTCT
TT
TTTTCTTCAAAGGAAGATATCCGTAGTTCAGATTGTGAGAGCAAAAGTTTTGAATTAACTACATCTTT
T
GAAGAATCAGAACGCAGACAAAATGCATTGGGGAAATGTGACGCTCCTCTCCTCGACAACAAAGTACAT
TTG
CTTTTTGACCAAGAGCATGAGTCAGCGTCCCAAAAGATGGAAGATGTCTGTAAAAGCCCCAAGCTGC
TG
CTGCTGAAATCCAATAGGGCAGCAAACAGTGTGCAGAGACATACTCCAAGGACCAAGATGAGACCTGT
A
AGCTTGCCTGTAGACCGGCTGCTTCTTCTTGCCAGTTCTCCTACTGAGAGAAGCAGCAGGGATGTAGGA
AAC
GTAGACTCAGACAAGTTTGGCAAGAACCCTGCCTTTGAAGGACTCCATAGAAAGGACAACTCAAATA
CT
ACTCGCTCCAAAGTTAATGGCTTTGACCAGCAAAATGTACAGAAATCCTGGGACACACAATATGTACG
G
AACAATTTTACTGCCAAGACTACGATGATTGTTCCCAGTGCCTACCCTGAGAAGGGATTGACAGTAAAC
ACT
GGGAATAACAGGGACCATCCCGGCAGTAAAGCACATGCAGAGCCAGCCAGGGCTGCAGGAGATGTGT
CA
GAGCGCAGGTCCTCTGACTCCTGCCCCGCCACTGCTGTCAGAGCACCCAGAACACTGCAGCCCCAACA
C
TGGACAACATTTTACAAACCACCTAATCCCACCTTCAGTGTCAGGGGGACTGAGGAGAAAACAGCATTA
CCC
TCAATAGCTGTACCTCCTGTCCTGGTGCATGCTCCCCAGATCCATGTGACAAAATCAGACCCAGACT
CA
GAGGCCACATTGGCCTGTCCTGTGCAGACAAGTGGTCAACCTAAAGAGAGCTCTGAGGAGCCTGCCCT
G
CCTGAGGGGACTCCAACTTGCCAGAGACCACGACTAAAACGAATGCAGCAATTTGAAGACCTTGAAGAT
GAA
ATCCCACAGTTTGTGTAG


Translation (1266 aa):
MIAHKQKKAKKKRVWASGQPSAAITTSEMGLKSVSSSSSFDPEYIKELVNDVRKFSHMLLYLKEAILSDC
F
KEVIHIRLDELLRVLKSILSKHQNLSSVDLQSAAEVLTAKVK
AVNFTEVNEENKNDIFREVFSSIETLA
F
TFGN
ILTNFLMGDVGSDSILRLPISRESKSFENISVDSVDLPHEKGNFSPIELDNLLLKNTDSIELALS
Y
AKTWSKYTKNIVSWVEKKLNL
ELESTRNIVKLAEATRSSIGIQEFMPLQSLFTNALLSDIHSSHLLQQT
I
AALQANKFVQ
PLLGRKNEMEKQRKEIKDLWKQQQNKLLETETALKKAKLLCMQRQDEYEKAKSSMFRAE
E
EQLSSSVGLAKNLNKQLEKRRRLEEEALQK
VEEANEHYKVCVTNVEERRNDLENTKREILTQLRTLVFQ
C
DLTLKA
VTVNLFHMQQLQAASLANSLQSLCDSAKLYDPGQEYSEFVKATSSSELEEKVDGNVNKQMTNS
P
QTSGYEPADSLEDVARLPDSCHKLEEDRCSNSADMT
GPSFVRSWKFGMFSDSESTGGSSESRSLDSESI
S
P
GDFHRKLPRTPSSGTMSSADDLDEREPPSPSEAGPNSLGAFKKTLMSKAALTHKFRKLRSPTKCRDCD
G
IVMFPGVECEE
CLLVCHRKCLENLVIICGHQKLQGKMHIFGAEFIQVAKKEPDGIPFVLKICASEIENR
A
LCLQ
GIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAK
E
IQHVNEEQEAKKDSPEDKKHPHVSIEVNRILLKSKDLLRQLPASHFNSLHYLIAHLR
RVVDHAEENKMN
S
KNLGVIFGPTLIRPRPTTAPVTISSLAEYSNQARLVEFLITYSQKIFDGSLQPQAVVISNTGAVAPQVD
Q
GYLPKPLLSPDERDTDHSMKPLFFSSKE
DIRSSDCESKSFELTTSFEESERRQNALGKCDAPLLDNKVH
L
LFDQEHESASQKMEDVCKSPKLLLLKSNRAANSVQRHTPRTKMRPVSLPVDRLLLLASSPTERSSRDVG
N
VDSDKFGKNPAFEGLHRKDNSNTTRSKVNGFDQQNVQKSWDTQYVRNNFTAKTTMIVPSAYPEKGLTVN
T
GNNRDHPGSKAHAEPARAAGDVSERRSSDSCPATAVRAPRTLQPQHWTTFYKPPNPTFSVRGTEEKTAL
P
SIAVPPVLVHAPQIHVTKSDPDSEATLACPVQTSGQPKESSEEPALPEGTPTCQRPRLKRMQQFEDLED
E
IPQFV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser