NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17367.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17367.1 Public Mus musculus 3 Eif2a 21 106 86 CCDS HistoryNCBI Gene:229317Re-query CCDS DB by CCDS ID:17367.1Re-query CCDS DB by GeneID:229317See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17367.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029387 ENSMUSP00000029387 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029387Link to Ensembl Protein Viewer:ENSMUSP00000029387Re-query CCDS DB by Nucleotide ID:ENSMUST00000029387Re-query CCDS DB by Protein ID:ENSMUSP00000029387
Original member Current member EBI,WTSI OTTMUST00000072738 OTTMUSP00000037517 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000072738Link to Vega Protein Viewer:OTTMUSP00000037517Re-query CCDS DB by Nucleotide ID:OTTMUST00000072738Re-query CCDS DB by Protein ID:OTTMUSP00000037517
Original member Current member NCBI NM_001005509.2 NP_001005509.1 Accepted alive Link to Nucleotide Sequence:NM_001005509.2Link to Protein Sequence:NP_001005509.1Re-query CCDS DB by Nucleotide ID:NM_001005509Re-query CCDS DB by Protein ID:NP_001005509Link to BLAST:NP_001005509.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001005509.1 581 Q8BJW6-1 581 100% 0 0

Chromosomal Locations for CCDS 17367.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 58526059 58526086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58531087 58531156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58537534 58537608 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58539528 58539646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58541040 58541139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58541634 58541716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58544995 58545068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58545228 58545372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58545500 58545616 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58548393 58548964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58552569 58552682 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58555535 58555651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58556573 58556638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 58557121 58557186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1746 nt):
ATGGCGCCGTCCACACCGCTGTTGACAGTCAGAGGATCAGAGGGACTGTACATGGTGAATGGACCACCAC
AC
TTCACAGAAAGCACGGTGCTTCCCAGAGAATCTGGAAGAAATTGCAAAGTGTACACTTTTAGTAAGGA
T
GGGACATTGTTTGCCTGGAGCAATGGAGAAAAAGTAAATATAATCAATGTCGCTAACAAGGGACTACTG
CAC
TCCTTCGACCTCCCAAAAGCAGTTTGCCTTGAATTCTCACCAAATAACACTGTCCTGGCAACGTGGC
AG
CCTTACACTACTTCTAAAGATGGCACTGCTGGGACGCCTAACCTACAACTTTATGACATGAAAACTGG
A
GCATGTTTGAAATCGTTCATCCAGAAAAAAATGCAAAATTGGTGTCCTTCCTGGTCAGATGATGAAATT
ATT
TGTGCCCGGAATGTTAACAACGAAGTTCACTTCTTTGAGAACAACAATTTTAACACAATTGCAAATA
AA
TTACATTTGCAAAAAGTTAATGACTTTAATTTATCACCTGGAACCCAACCTTATAAGGTGGCAGTTTA
T
GTCCCAGGAAGTAAAGGTGCCCCCTCATTTGTTCGACTGTATCAGTATCCCAACTTTGCCGGACCTCAG
GCA
GCACTGGCCAATAAAAGCTTCTTTAAAGCTGATAAGGTTACAATGCTGTGGAATAAAAAAGCTACTG
CT
GTGCTGGTAATAGCCAGTACAGAGGTTGACAAGACAGGAGCCTCCTACTATGGAGAACAAACACTGCA
C
TACATTGCAACAAATGGAGAAAGTGCTGTGGTACAATTACCAAAAAATGGCCCAATTTATGATGTAGTT
TGG
AATTCCAGTTCTACTGAGTTTTGCGCTGTTTATGGTTTTATGCCTGCGAAAGCAACAGTTTTCAACC
TG
AAGTGTGATCCTGTGTTTGACTTTGGGACTGGTCCTCGCAACGCAGCCTTCTATAGCCCTCATGGACA
T
ATATTAGTGCTGGCTGGATTTGGAAATCTTCGAGGACAAATGGAAGTATGGGATGTTAAAAACTACAAG
CTT
ATTTCTAAGCCAGTGGCTTCTGATTCTACATATTTTGCCTGGTGCCCAGATGGTGAGCATATCTTAA
CA
GCCACATGTGCTCCTAGGTTACGTGTTAATAATGGGTATAAGATCTGGCATTATACTGGCTCTCTTTT
G
CATAAGTATGATGTGCCATCAAATGGAGAATTATGGCAGGTTTCTTGGCAGCCATTTTTGGATGGAATA
TTT
CCAGCAAAAACGATAAAGTACCAAGCAGTTCCAAGTGAAGTGCCTAGTGAGGAGCCTAAAGTTGCAA
CA
GCTTATAGACCTCCAGCCTTAAGAAATAAGCCAGTCACCAATTCCAAACTGCATGAAGAGGAACCTCC
C
CAGAATATGAAGCCACATCCAGGAAGTGACAAGCCATTATCAAAAACAGCCCTTAAAAATCAAAGGAAG
CAT
GAAGCTAAAAAAGCTGCAAAACAGGAAGCAAGAAGTGATGCGGCTCCTACTCCTGTCCCACAGAGTG
CA
CCACGGAACACGGTCACCCAGTCTGCTTCTGGTGATCCTGAAGTAGACAAAAAAATTAAGAATCTAAA
G
AAGAAACTGAAAGCCATAGAGCAGCTAAAAGAGCAGGCAGCCGCCGGGAAACAGCTAGAAAAAAATCAG
TTG
GAGAAAATTCAGAAAGAGACAGCCCTTCTCCAAGAGCTTGAAGATTTGGAATTGGGAGTTTGA


Translation (581 aa):
MAPSTPLLTVRGSEGLYMVNGPPHFTESTVLPRESGRNCKVYTFSKDGTLFAWSNGEKVNIINVANKGLL
H
SFDLPKAVCLEFSPNNTVLATWQPYT
TSKDGTAGTPNLQLYDMKTGACLKSFIQKKMQNWCPSWSDDEI
I
CARNVNNEVHFFENNNF
NTIANKLHLQKVNDFNLSPGTQPYKVAVYVPGSKGAPSFVRLYQYPNFAGPQ
A
ALANKSFFKADKVTMLWNKK
ATAVLVIASTEVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVV
W
NSSSTEFCAVYGFMPAKATVFNLKCDPVFDFGTGPRNAAFYSPHGHILVLAGFGNLRGQMEVWDVKNYK
L
ISKPVASDSTYFAWCPDGEHILTATCAPRLRVNNGYKIWHYTGSLLHKYDVPSNGELWQVSWQPFLDGI
F
PAKTIKYQAVPSEVPSEEPKVATAYRPPALRNKPVTNSKL
HEEEPPQNMKPHPGSDKPLSKTALKNQRK
H
EAKKAAKQ
EARSDAAPTPVPQSAPRNTVTQSASGDPEVDKKIKNLKKKLKAIEQLKEQAAAGKQLEKNQ
L
EKIQKETALLQELEDLELGV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser