NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15895.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15895.1 Public Mus musculus 2 Gpr107 21 106 86 CCDS HistoryNCBI Gene:277463Re-query CCDS DB by CCDS ID:15895.1Re-query CCDS DB by GeneID:277463See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15895.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000056433 ENSMUSP00000056739 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000056433Link to Ensembl Protein Viewer:ENSMUSP00000056739Re-query CCDS DB by Nucleotide ID:ENSMUST00000056433Re-query CCDS DB by Protein ID:ENSMUSP00000056739
Original member Current member EBI,WTSI OTTMUST00000028145 OTTMUSP00000012741 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000028145Link to Vega Protein Viewer:OTTMUSP00000012741Re-query CCDS DB by Nucleotide ID:OTTMUST00000028145Re-query CCDS DB by Protein ID:OTTMUSP00000012741
Original member Current member NCBI NM_178760.4 NP_848875.2 Accepted alive Link to Nucleotide Sequence:NM_178760.4Link to Protein Sequence:NP_848875.2Re-query CCDS DB by Nucleotide ID:NM_178760Re-query CCDS DB by Protein ID:NP_848875Link to BLAST:NP_848875.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848875.2 551 Q8BUV8 551 100% 0 0

Chromosomal Locations for CCDS 15895.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 31152359 31152481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31167021 31167143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31168164 31168214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31168797 31168879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31171942 31172081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31174202 31174239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31176898 31176954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31177785 31177895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31178254 31178387 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31183580 31183655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31184798 31184871 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31185489 31185606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31188683 31188813 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31191847 31191890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31207679 31207728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31209067 31209150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31210449 31210570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 31214244 31214340 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1656 nt):
ATGGCCGTCCCGGTACCCCTCGGCCGCTTCGGCTCCTTCTGCCTGCGGCTGCTACGACTGCTGGCGTTGC
TG
GAGCTGCTGGTCCACCCCGTCTTGGGCCGCGTCCATCACCTGGCGCTCAAAGATGATGTGCGGCATAA
A
GTCCATCTCAACACCTTCGGGTTCTTCAAGGATGGGTACATGGTGGTCAACGTCAGCAGCCTCTCTGTG
AAC
GAGCCTGAGGGAGCCACGGACAAGGATGCTGAGATCGGATTCAGTCTGGATCGGACTAAGAACGATG
GC
TTTTCTTCTTACCTGGATGAAGATGTGAATTACTGTATTTTAAAAAAGAAGTCCATGTCTTCTGTCAC
T
CTTGTCATCTTAGACATCTCTGGAAGCATAGTCAAGGTCAGATCCCCACCAGAAGCTGGTAAGCAGTTA
CCA
GAGATTGTCTTCAGCAAGGATGAGAAAATCCTGAGTCAGAGCCAGGAGCCTGCTGTCAGCTCCAACC
CC
AAAGACAGTGAGGCTCGGAGAACCCTCGATGGTTTCAAGGCTGGACGAAGTACAGTGGACTCAAAGGC
T
ATCACAGAGCGATCCTTCTCAATTCACAAGAATGACGGGGTGGTCTCATTTCAGTTCTTCTTTAACATC
AGC
ACCGATGACCAGGAAGGCCTCTACAGCCTTTACTTCCACAAGTGCTCAGGCAACAACGTGAAGCCTG
GT
GAACAGGCCTCATTCAGCCTGAATATTGCTATCACAGAGAAGAACCCTAACAGCTACCTCTCTGCCGG
G
GAAATCCCTCTCCCCAAGTTATATGTTTCCATGGCCTTGTTCTTCTTTCTGTCTGGGACCATTTGGATT
CAC
ATCCTTCGTAAGAGAAGGAATGATGTATTTAAAATTCACTGGTTGATGGCCGCCCTTCCTTTCACCA
AG
TCTCTCTCGTTGGTGTTCCATGCAATCGACTACCACTACATCTCCTCGCAGGGCTTTCCGATTGAAGG
C
TGGGCTGTTGTATACTACATAACTCACCTGCTAAAGGGCGCACTCCTGTTCATCACCATCGCCCTCATC
GGC
ACTGGCTGGGCCTTCATCAAGCACATCCTGTCTGATAAAGACAAGAAGATCTTCATGATTGTCATCC
CG
CTCCAGGTCCTGGCGAATGTGGCCTACATCATCATAGAGTCCACTGAGGAGGGCACAACTGAGTATGG
C
CTATGGAAGGACTCTCTGTTCCTGGTTGACTTGCTTTGCTGTGGCGCCATCCTCTTCCCAGTGGTGTGG
TCA
ATCAGGCATTTACAAGAAGCCTCCGCCACAGATGGAAAAGCTGCCATTAACTTAGCGAAGCTGAGGC
TT
TTCAGACATTACTACGTCTTGATTGTGTGCTACATCTACTTTACCAGGATCATCGCCTTCCTTCTCAA
G
TTTGCTGTTCCATTCCAGTGGAAGTGGCTCTACCAGCTGCTGGATGAAACAGCCACGCTGGTGTTCTTT
GTC
CTGACGGGGTATAAATTTCGCCCAGCTTCAGATAACCCCTACCTGCAGCTCTCTCAGGAAGATGATG
AC
CTGGAGATGGAGTCCGTAGTGACGACATCGGGTGTGATGGAGAATATGAAGAAGGTGAAGAAAGTGAG
C
AACGGTGCTGTGGAGCCCCAGGGCAGCTGGGAAGGCACCGCGTGA


Translation (551 aa):
MAVPVPLGRFGSFCLRLLRLLALLELLVHPVLGRVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSV
N
EPEGATDKDAE
IGFSLDRTKNDGFSSYLDEDVNYCILKKKSMSSVTLVILDISGSIVKVRSPPEAGKQL
P
EIVFSKDEKILSQSQEPAVSSNPKDSEARRTL
DGFKAGRSTVDSKAITERSFSIHKNDGVVSFQFFFNI
S
TDDQEGLYSLYFHKCSGNNVKPGEQASFSLN
IAITEKNPNSYLSAGEIPLPKLYVSMALFFFLSGTIWI
H
ILRKR
RNDVFKIHWLMAALPFTKSLSLVFHAIDYHYISSQGFPIEGWAVVYYITHLLKGALLFITIALI
G
TGWAFIKHILSDKDKKIFMIVIPLQ
VLANVAYIIIESTEEGTTEYGLWKDSLFLVDLLCCGAILFPVVW
S
IRHLQEASATDGK
AAINLAKLRLFRHYYVLIVCYIYFTRIIAFLLKFAVPFQWKWLYQLLDETATLVFF
V
LTGYKFRPASDNPYLQLSQEDDDLEMES
VVTTSGVMENMKKVKKVSNGAVEPQGSWEGTA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser