NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1239.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1239.1 Public Homo sapiens 1 UHMK1 22 109 92 CCDS HistoryNCBI Gene:127933Re-query CCDS DB by CCDS ID:1239.1Re-query CCDS DB by GeneID:127933See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1239.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000489294.1 ENSP00000420270.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000489294.1Link to Ensembl Protein Viewer:ENSP00000420270.1Re-query CCDS DB by Nucleotide ID:ENST00000489294Re-query CCDS DB by Protein ID:ENSP00000420270
Original member NCBI NM_175866.4 NP_787062.1 Updated not alive Link to Nucleotide Sequence:NM_175866.4Link to Protein Sequence:NP_787062.1Re-query CCDS DB by Nucleotide ID:NM_175866Re-query CCDS DB by Protein ID:NP_787062
Current member NCBI NM_175866.5 NP_787062.1 Accepted alive Link to Nucleotide Sequence:NM_175866.5Link to Protein Sequence:NP_787062.1Re-query CCDS DB by Nucleotide ID:NM_175866Re-query CCDS DB by Protein ID:NP_787062Link to BLAST:NP_787062.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_787062.1 419 Q8TAS1-1 419 100% 0 0

Chromosomal Locations for CCDS 1239.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 162498001 162498268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 162499955 162500247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 162500913 162501104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 162503754 162503848 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 162512500 162512576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 162512725 162512823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 162518102 162518190 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 162522404 162522550 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1260 nt):
ATGGCGGGATCCGGCTGCGCCTGGGGCGCGGAGCCGCCGCGTTTTCTGGAGGCCTTCGGGCGGCTGTGGC
AG
GTACAGAGCCGTCTGGGTAGCGGCTCCTCCGCCTCGGTGTATCGGGTTCGCTGCTGCGGCAACCCTGG
C
TCGCCCCCCGGCGCCCTCAAGCAGTTCTTGCCGCCAGGAACCACCGGGGCTGCGGCCTCTGCCGCCGAG
TAT
GGTTTCCGCAAAGAGAGGGCGGCGCTGGAACAGTTGCAGGGTCACAGAAACATCGTGACTTTGTATG
GA
GTGTTTACAATCCACTTTTCTCCAAATGTGCCATCACGCTGTCTGTTGCTTGAACTCCTGGATGTCAG
T
GTTTCGGAATTGCTCTTATATTCCAGTCACCAGGGTTGTTCCATGTGGATGATACAGCATTGTGCCCGA
GAT
GTTTTGGAGGCCCTTGCTTTTCTTCATCATGAGGGCTATGTCCATGCGGACCTCAAACCACGTAACA
TA
TTGTGGAGTGCAGAGAATGAATGTTTTAAACTCATTGACTTTGGACTTAGCTTCAAAGAAGGCAATCA
G
GATGTAAAGTATATTCAGACAGACGGGTATCGGGCTCCAGAAGCAGAATTGCAAAATTGCTTGGCCCAG
GCT
GGCCTGCAGAGTGATACAGAATGTACCTCAGCTGTTGATCTGTGGAGCCTAGGAATCATTTTACTGG
AA
ATGTTCTCAGGAATGAAACTGAAACATACAGTCAGATCTCAGGAATGGAAGGCAAACAGTTCTGCTAT
T
ATTGATCACATATTTGCCAGTAAAGCAGTGGTGAATGCCGCAATTCCAGCCTATCACCTAAGAGACCTT
ATC
AAAAGCATGCTTCATGATGATCCAAGCAGAAGAATTCCTGCTGAAATGGCATTGTGCAGCCCATTCT
TT
AGCATTCCTTTTGCCCCTCATATTGAAGATCTGGTCATGCTTCCCACTCCAGTGCTAAGACTGCTGAA
T
GTGCTGGATGATGATTATCTTGAGAATGAAGAGGAATATGAAGATGTTGTAGAAGATGTAAAAGAGGAG
TGT
CAAAAATATGGACCAGTGGTATCTCTACTTGTTCCAAAGGAAAATCCTGGCAGAGGACAAGTCTTTG
TT
GAGTATGCAAATGCTGGTGATTCCAAAGCTGCGCAGAAATTACTGACTGGAAGGATGTTTGATGGGAA
G
TTTGTTGTGGCTACATTCTACCCGCTGAGTGCCTACAAGAGGGGATATCTGTATCAAACCTTGCTTTAA


Translation (419 aa):
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAE
Y
GFRKERAALEQLQGHRNI
VTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCAR
D
VLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQ
DVKYIQTDGYRAPEAELQNCLAQ
A
GLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWK
ANSSAIIDHIFASKAVVNAAIPAYHLRDL
I
K
SMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEE
C
QKYGPVVSLLVPKENPGRGQ
VFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser