NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10956.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10956.1 Public Homo sapiens 16 IRF8 22 109 92 CCDS HistoryNCBI Gene:3394Re-query CCDS DB by CCDS ID:10956.1Re-query CCDS DB by GeneID:3394See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10956.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000268638.9 ENSP00000268638.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000268638.9Link to Ensembl Protein Viewer:ENSP00000268638.4Re-query CCDS DB by Nucleotide ID:ENST00000268638Re-query CCDS DB by Protein ID:ENSP00000268638
Original member NCBI NM_002163.2 NP_002154.1 Updated not alive Link to Nucleotide Sequence:NM_002163.2Link to Protein Sequence:NP_002154.1Re-query CCDS DB by Nucleotide ID:NM_002163Re-query CCDS DB by Protein ID:NP_002154
NCBI NM_002163.3 NP_002154.1 Updated not alive Link to Nucleotide Sequence:NM_002163.3Link to Protein Sequence:NP_002154.1Re-query CCDS DB by Nucleotide ID:NM_002163Re-query CCDS DB by Protein ID:NP_002154
Current member NCBI NM_002163.4 NP_002154.1 Accepted alive Link to Nucleotide Sequence:NM_002163.4Link to Protein Sequence:NP_002154.1Re-query CCDS DB by Nucleotide ID:NM_002163Re-query CCDS DB by Protein ID:NP_002154Link to BLAST:NP_002154.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002154.1 426 Q02556 426 100% 0 0

Chromosomal Locations for CCDS 10956.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 85903016 85903189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85908990 85909173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85911570 85911658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85913131 85913236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85914473 85914520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85918417 85918803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85920109 85920224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85921106 85921282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1281 nt):
ATGTGTGACCGGAATGGTGGTCGGCGGCTTCGACAGTGGCTGATCGAGCAGATTGACAGTAGCATGTATC
CA
GGACTGATTTGGGAGAATGAGGAGAAGAGCATGTTCCGGATCCCTTGGAAACACGCTGGCAAGCAAGA
T
TATAATCAGGAAGTGGATGCCTCCATTTTTAAGGCCTGGGCAGTTTTTAAAGGGAAGTTTAAAGAAGGG
GAC
AAAGCTGAACCAGCCACTTGGAAGACGAGGTTACGCTGTGCTTTGAATAAGAGCCCAGATTTTGAGG
AA
GTGACGGACCGGTCCCAACTGGACATTTCCGAGCCATACAAAGTTTACCGAATTGTTCCTGAGGAAGA
G
CAAAAATGCAAACTAGGCGTGGCAACTGCTGGCTGCGTGAATGAAGTTACAGAGATGGAGTGCGGTCGC
TCT
GAAATCGACGAGCTGATCAAGGAGCCTTCTGTGGACGATTACATGGGGATGATCAAAAGGAGCCCTT
CC
CCGCCGGAGGCCTGTCGGAGTCAGCTCCTTCCAGACTGGTGGGCGCAGCAGCCCAGCACAGGCGTGCC
G
CTGGTGACGGGGTACACCACCTACGACGCGCACCATTCAGCATTCTCCCAGATGGTGATCAGCTTCTAC
TAT
GGGGGCAAGCTGGTGGGCCAGGCCACCACCACCTGCCCCGAGGGCTGCCGCCTGTCCCTGAGCCAGC
CT
GGGCTGCCCGGCACCAAGCTGTATGGGCCCGAGGGCCTGGAGCTGGTGCGCTTCCCGCCGGCCGACGC
C
ATCCCCAGCGAGCGACAGAGGCAGGTGACGCGGAAGCTGTTCGGGCACCTGGAGCGCGGGGTGCTGCTG
CAC
AGCAGCCGGCAGGGCGTGTTCGTCAAGCGGCTGTGCCAGGGCCGCGTGTTCTGCAGCGGCAACGCCG
TG
GTGTGCAAAGGCAGGCCCAACAAGCTGGAGCGTGATGAGGTGGTCCAGGTCTTCGACACCAGCCAGTT
C
TTCCGAGAGCTGCAGCAGTTCTATAACAGCCAGGGCCGGCTTCCTGACGGCAGGGTGGTGCTGTGCTTT
GGG
GAAGAGTTTCCGGATATGGCCCCCTTGCGCTCCAAACTCATTCTCGTGCAGATTGAGCAGCTGTATG
TC
CGGCAACTGGCAGAAGAGGCTGGGAAGAGCTGTGGAGCCGGCTCTGTGATGCAGGCCCCCGAGGAGCC
G
CCGCCAGACCAGGTCTTCCGGATGTTTCCAGATATTTGTGCCTCACACCAGAGATCATTTTTCAGAGAA
AAC
CAACAGATCACCGTCTAA


Translation (426 aa):
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEG
D
KAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQK
CKLGVATAGCVNEVTEMECGR
S
EIDELIKE
PSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFY
Y
GGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLL
H
SSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFR
ELQQFYNSQGRLPDGRVVLCF
G
EEFPDMAPLRSKLILVQ
IEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRE
N
QQITV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser