NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10593.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10593.1 Public Homo sapiens 16 LYRM1 22 109 92 CCDS HistoryNCBI Gene:57149Re-query CCDS DB by CCDS ID:10593.1Re-query CCDS DB by GeneID:57149See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10593.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000219168.8 ENSP00000219168.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000219168.8Link to Ensembl Protein Viewer:ENSP00000219168.4Re-query CCDS DB by Nucleotide ID:ENST00000219168Re-query CCDS DB by Protein ID:ENSP00000219168
Original member Current member EBI,WTSI ENST00000396052.3 ENSP00000379367.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000396052.3Link to Ensembl Protein Viewer:ENSP00000379367.2Re-query CCDS DB by Nucleotide ID:ENST00000396052Re-query CCDS DB by Protein ID:ENSP00000379367
Original member Current member EBI,WTSI ENST00000439021.5 ENSP00000407883.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000439021.5Link to Ensembl Protein Viewer:ENSP00000407883.1Re-query CCDS DB by Nucleotide ID:ENST00000439021Re-query CCDS DB by Protein ID:ENSP00000407883
Original member Current member EBI,WTSI ENST00000569023.5 ENSP00000454551.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000569023.5Link to Ensembl Protein Viewer:ENSP00000454551.1Re-query CCDS DB by Nucleotide ID:ENST00000569023Re-query CCDS DB by Protein ID:ENSP00000454551
Original member Current member EBI,WTSI ENST00000568663.5 ENSP00000454826.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000568663.5Link to Ensembl Protein Viewer:ENSP00000454826.1Re-query CCDS DB by Nucleotide ID:ENST00000568663Re-query CCDS DB by Protein ID:ENSP00000454826
Original member Current member EBI,WTSI ENST00000567954.5 ENSP00000457333.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000567954.5Link to Ensembl Protein Viewer:ENSP00000457333.1Re-query CCDS DB by Nucleotide ID:ENST00000567954Re-query CCDS DB by Protein ID:ENSP00000457333
Original member NCBI NM_001128301.2 NP_001121773.1 Updated not alive Link to Nucleotide Sequence:NM_001128301.2Link to Protein Sequence:NP_001121773.1Re-query CCDS DB by Nucleotide ID:NM_001128301Re-query CCDS DB by Protein ID:NP_001121773
Current member NCBI NM_001128301.3 NP_001121773.1 Accepted alive Link to Nucleotide Sequence:NM_001128301.3Link to Protein Sequence:NP_001121773.1Re-query CCDS DB by Nucleotide ID:NM_001128301Re-query CCDS DB by Protein ID:NP_001121773Link to BLAST:NP_001121773.1
Original member NCBI NM_001128302.2 NP_001121774.1 Updated not alive Link to Nucleotide Sequence:NM_001128302.2Link to Protein Sequence:NP_001121774.1Re-query CCDS DB by Nucleotide ID:NM_001128302Re-query CCDS DB by Protein ID:NP_001121774
Current member NCBI NM_001128302.3 NP_001121774.1 Accepted alive Link to Nucleotide Sequence:NM_001128302.3Link to Protein Sequence:NP_001121774.1Re-query CCDS DB by Nucleotide ID:NM_001128302Re-query CCDS DB by Protein ID:NP_001121774Link to BLAST:NP_001121774.1
Original member NCBI NM_001302835.1 NP_001289764.1 Updated not alive Link to Nucleotide Sequence:NM_001302835.1Link to Protein Sequence:NP_001289764.1Re-query CCDS DB by Nucleotide ID:NM_001302835Re-query CCDS DB by Protein ID:NP_001289764
Current member NCBI NM_001302835.2 NP_001289764.1 Accepted alive Link to Nucleotide Sequence:NM_001302835.2Link to Protein Sequence:NP_001289764.1Re-query CCDS DB by Nucleotide ID:NM_001302835Re-query CCDS DB by Protein ID:NP_001289764Link to BLAST:NP_001289764.1
Original member NCBI NM_001302836.1 NP_001289765.1 Updated not alive Link to Nucleotide Sequence:NM_001302836.1Link to Protein Sequence:NP_001289765.1Re-query CCDS DB by Nucleotide ID:NM_001302836Re-query CCDS DB by Protein ID:NP_001289765
Current member NCBI NM_001302836.2 NP_001289765.1 Accepted alive Link to Nucleotide Sequence:NM_001302836.2Link to Protein Sequence:NP_001289765.1Re-query CCDS DB by Nucleotide ID:NM_001302836Re-query CCDS DB by Protein ID:NP_001289765Link to BLAST:NP_001289765.1
Original member NCBI NM_020424.4 NP_065157.1 Updated not alive Link to Nucleotide Sequence:NM_020424.4Link to Protein Sequence:NP_065157.1Re-query CCDS DB by Nucleotide ID:NM_020424Re-query CCDS DB by Protein ID:NP_065157
Current member NCBI NM_020424.5 NP_065157.1 Accepted alive Link to Nucleotide Sequence:NM_020424.5Link to Protein Sequence:NP_065157.1Re-query CCDS DB by Nucleotide ID:NM_020424Re-query CCDS DB by Protein ID:NP_065157Link to BLAST:NP_065157.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001121773.1 122 O43325 122 100% 0 0
NP_001121774.1 122 O43325 122 100% 0 0
NP_001289764.1 122 O43325 122 100% 0 0
NP_001289765.1 122 O43325 122 100% 0 0
NP_065157.1 122 O43325 122 100% 0 0

Chromosomal Locations for CCDS 10593.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 20915556 20915714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20920122 20920214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 20924000 20924116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (369 nt):
ATGACAACGGCAACACGACAAGAAGTCCTTGGCCTCTACCGCAGCATTTTCAGGCTTGCGAGGAAATGGC
AG
GCGACATCAGGGCAGATGGAAGACACCATCAAAGAAAAACAGTACATACTAAATGAAGCCAGAACGCT
G
TTCCGGAAAAACAAAAATCTCACGGACACAGACCTAATTAAACAGTGTATAGATGAATGCACAGCCAGG
ATT
GAAATTGGACTGCATTACAAGATTCCTTACCCAAGGCCAATTCATCTGCCTCCAATGGGCCTTACCC
CA
CTCCGAGGCCGGGGACTTCGAAGCCAAGAGAAACTGAGGAAACTTTCCAAACCAGTATATCTCAGATC
T
CATGATGAAGTTTCCTAA


Translation (122 aa):
MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTAR
I
EIGLHYKIPYPRP
IHLPPMGLTPLRGRGLRSQEKLRKLSKPVYLRSHDEVS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser