NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10378.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10378.1 Public Homo sapiens 15 IGF1R 22 109 92 CCDS HistoryNCBI Gene:3480Re-query CCDS DB by CCDS ID:10378.1Re-query CCDS DB by GeneID:3480See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10378.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000268035.10 ENSP00000268035.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000268035.10Link to Ensembl Protein Viewer:ENSP00000268035.6Re-query CCDS DB by Nucleotide ID:ENST00000268035Re-query CCDS DB by Protein ID:ENSP00000268035
Original member NCBI NM_000875.4 NP_000866.1 Updated not alive Link to Nucleotide Sequence:NM_000875.4Link to Protein Sequence:NP_000866.1Re-query CCDS DB by Nucleotide ID:NM_000875Re-query CCDS DB by Protein ID:NP_000866
Current member NCBI NM_000875.5 NP_000866.1 Accepted alive Link to Nucleotide Sequence:NM_000875.5Link to Protein Sequence:NP_000866.1Re-query CCDS DB by Nucleotide ID:NM_000875Re-query CCDS DB by Protein ID:NP_000866Link to BLAST:NP_000866.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000866.1 1367 P08069 1367 100% 0 0

Chromosomal Locations for CCDS 10378.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 98649582 98649675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98707562 98708107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98891325 98891637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98896757 98896905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98899477 98899621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98908685 98908899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98911315 98911441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98913044 98913282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98915964 98916131 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98916672 98916876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98922148 98922431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98923876 98924012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98924525 98924684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98929558 98929660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98930235 98930305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98934824 98935053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98935316 98935426 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98939201 98939360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98942923 98943052 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98948574 98948708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 98957061 98957442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4104 nt):
ATGAAGTCTGGCTCCGGAGGAGGGTCCCCGACCTCGCTGTGGGGGCTCCTGTTTCTCTCCGCCGCGCTCT
CG
CTCTGGCCGACGAGTGGAGAAATCTGCGGGCCAGGCATCGACATCCGCAACGACTATCAGCAGCTGAA
G
CGCCTGGAGAACTGCACGGTGATCGAGGGCTACCTCCACATCCTGCTCATCTCCAAGGCCGAGGACTAC
CGC
AGCTACCGCTTCCCCAAGCTCACGGTCATTACCGAGTACTTGCTGCTGTTCCGAGTGGCTGGCCTCG
AG
AGCCTCGGAGACCTCTTCCCCAACCTCACGGTCATCCGCGGCTGGAAACTCTTCTACAACTACGCCCT
G
GTCATCTTCGAGATGACCAATCTCAAGGATATTGGGCTTTACAACCTGAGGAACATTACTCGGGGGGCC
ATC
AGGATTGAGAAAAATGCTGACCTCTGTTACCTCTCCACTGTGGACTGGTCCCTGATCCTGGATGCGG
TG
TCCAATAACTACATTGTGGGGAATAAGCCCCCAAAGGAATGTGGGGACCTGTGTCCAGGGACCATGGA
G
GAGAAGCCGATGTGTGAGAAGACCACCATCAACAATGAGTACAACTACCGCTGCTGGACCACAAACCGC
TGC
CAGAAAATGTGCCCAAGCACGTGTGGGAAGCGGGCGTGCACCGAGAACAATGAGTGCTGCCACCCCG
AG
TGCCTGGGCAGCTGCAGCGCGCCTGACAACGACACGGCCTGTGTAGCTTGCCGCCACTACTACTATGC
C
GGTGTCTGTGTGCCTGCCTGCCCGCCCAACACCTACAGGTTTGAGGGCTGGCGCTGTGTGGACCGTGAC
TTC
TGCGCCAACATCCTCAGCGCCGAGAGCAGCGACTCCGAGGGGTTTGTGATCCACGACGGCGAGTGCA
TG
CAGGAGTGCCCCTCGGGCTTCATCCGCAACGGCAGCCAGAGCATGTACTGCATCCCTTGTGAAGGTCC
T
TGCCCGAAGGTCTGTGAGGAAGAAAAGAAAACAAAGACCATTGATTCTGTTACTTCTGCTCAGATGCTC
CAA
GGATGCACCATCTTCAAGGGCAATTTGCTCATTAACATCCGACGGGGGAATAACATTGCTTCAGAGC
TG
GAGAACTTCATGGGGCTCATCGAGGTGGTGACGGGCTACGTGAAGATCCGCCATTCTCATGCCTTGGT
C
TCCTTGTCCTTCCTAAAAAACCTTCGCCTCATCCTAGGAGAGGAGCAGCTAGAAGGGAATTACTCCTTC
TAC
GTCCTCGACAACCAGAACTTGCAGCAACTGTGGGACTGGGACCACCGCAACCTGACCATCAAAGCAG
GG
AAAATGTACTTTGCTTTCAATCCCAAATTATGTGTTTCCGAAATTTACCGCATGGAGGAAGTGACGGG
G
ACTAAAGGGCGCCAAAGCAAAGGGGACATAAACACCAGGAACAACGGGGAGAGAGCCTCCTGTGAAAGT
GAC
GTCCTGCATTTCACCTCCACCACCACGTCGAAGAATCGCATCATCATAACCTGGCACCGGTACCGGC
CC
CCTGACTACAGGGATCTCATCAGCTTCACCGTTTACTACAAGGAAGCACCCTTTAAGAATGTCACAGA
G
TATGATGGGCAGGATGCCTGCGGCTCCAACAGCTGGAACATGGTGGACGTGGACCTCCCGCCCAACAAG
GAC
GTGGAGCCCGGCATCTTACTACATGGGCTGAAGCCCTGGACTCAGTACGCCGTTTACGTCAAGGCTG
TG
ACCCTCACCATGGTGGAGAACGACCATATCCGTGGGGCCAAGAGTGAGATCTTGTACATTCGCACCAA
T
GCTTCAGTTCCTTCCATTCCCTTGGACGTTCTTTCAGCATCGAACTCCTCTTCTCAGTTAATCGTGAAG
TGG
AACCCTCCCTCTCTGCCCAACGGCAACCTGAGTTACTACATTGTGCGCTGGCAGCGGCAGCCTCAGG
AC
GGCTACCTTTACCGGCACAATTACTGCTCCAAAGACAAAATCCCCATCAGGAAGTATGCCGACGGCAC
C
ATCGACATTGAGGAGGTCACAGAGAACCCCAAGACTGAGGTGTGTGGTGGGGAGAAAGGGCCTTGCTGC
GCC
TGCCCCAAAACTGAAGCCGAGAAGCAGGCCGAGAAGGAGGAGGCTGAATACCGCAAAGTCTTTGAGA
AT
TTCCTGCACAACTCCATCTTCGTGCCCAGACCTGAAAGGAAGCGGAGAGATGTCATGCAAGTGGCCAA
C
ACCACCATGTCCAGCCGAAGCAGGAACACCACGGCCGCAGACACCTACAACATCACCGACCCGGAAGAG
CTG
GAGACAGAGTACCCTTTCTTTGAGAGCAGAGTGGATAACAAGGAGAGAACTGTCATTTCTAACCTTC
GG
CCTTTCACATTGTACCGCATCGATATCCACAGCTGCAACCACGAGGCTGAGAAGCTGGGCTGCAGCGC
C
TCCAACTTCGTCTTTGCAAGGACTATGCCCGCAGAAGGAGCAGATGACATTCCTGGGCCAGTGACCTGG
GAG
CCAAGGCCTGAAAACTCCATCTTTTTAAAGTGGCCGGAACCTGAGAATCCCAATGGATTGATTCTAA
TG
TATGAAATAAAATACGGATCACAAGTTGAGGATCAGCGAGAATGTGTGTCCAGACAGGAATACAGGAA
G
TATGGAGGGGCCAAGCTAAACCGGCTAAACCCGGGGAACTACACAGCCCGGATTCAGGCCACATCTCTC
TCT
GGGAATGGGTCGTGGACAGATCCTGTGTTCTTCTATGTCCAGGCCAAAACAGGATATGAAAACTTCA
TC
CATCTGATCATCGCTCTGCCCGTCGCTGTCCTGTTGATCGTGGGAGGGTTGGTGATTATGCTGTACGT
C
TTCCATAGAAAGAGAAATAACAGCAGGCTGGGGAATGGAGTGCTGTATGCCTCTGTGAACCCGGAGTAC
TTC
AGCGCTGCTGATGTGTACGTTCCTGATGAGTGGGAGGTGGCTCGGGAGAAGATCACCATGAGCCGGG
AA
CTTGGGCAGGGGTCGTTTGGGATGGTCTATGAAGGAGTTGCCAAGGGTGTGGTGAAAGATGAACCTGA
A
ACCAGAGTGGCCATTAAAACAGTGAACGAGGCCGCAAGCATGCGTGAGAGGATTGAGTTTCTCAACGAA
GCT
TCTGTGATGAAGGAGTTCAATTGTCACCATGTGGTGCGATTGCTGGGTGTGGTGTCCCAAGGCCAGC
CA
ACACTGGTCATCATGGAACTGATGACACGGGGCGATCTCAAAAGTTATCTCCGGTCTCTGAGGCCAGA
A
ATGGAGAATAATCCAGTCCTAGCACCTCCAAGCCTGAGCAAGATGATTCAGATGGCCGGAGAGATTGCA
GAC
GGCATGGCATACCTCAACGCCAATAAGTTCGTCCACAGAGACCTTGCTGCCCGGAATTGCATGGTAG
CC
GAAGATTTCACAGTCAAAATCGGAGATTTTGGTATGACGCGAGATATCTATGAGACAGACTATTACCG
G
AAAGGAGGGAAAGGGCTGCTGCCCGTGCGCTGGATGTCTCCTGAGTCCCTCAAGGATGGAGTCTTCACC
ACT
TACTCGGACGTCTGGTCCTTCGGGGTCGTCCTCTGGGAGATCGCCACACTGGCCGAGCAGCCCTACC
AG
GGCTTGTCCAACGAGCAAGTCCTTCGCTTCGTCATGGAGGGCGGCCTTCTGGACAAGCCAGACAACTG
T
CCTGACATGCTGTTTGAACTGATGCGCATGTGCTGGCAGTATAACCCCAAGATGAGGCCTTCCTTCCTG
GAG
ATCATCAGCAGCATCAAAGAGGAGATGGAGCCTGGCTTCCGGGAGGTCTCCTTCTACTACAGCGAGG
AG
AACAAGCTGCCCGAGCCGGAGGAGCTGGACCTGGAGCCAGAGAACATGGAGAGCGTCCCCCTGGACCC
C
TCGGCCTCCTCGTCCTCCCTGCCACTGCCCGACAGACACTCAGGACACAAGGCCGAGAACGGCCCCGGC
CCT
GGGGTGCTGGTCCTCCGCGCCAGCTTCGACGAGAGACAGCCTTACGCCCACATGAACGGGGGCCGCA
AG
AACGAGCGGGCCTTGCCGCTGCCCCAGTCTTCGACCTGCTGA


Translation (1367 aa):
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDY
R
SYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGA
I
RIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNR
C
QK
MCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRD
F
CANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQ
SMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQML
Q
GCTIFKGNLLINIRRG
NNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
Y
VLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERAS
CES
D
VLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKE
APFKNVTEYDGQDACGSNSWNMVDVDLPPNK
D
VEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNAS
VPSIPLDVLSASNSSSQLIVK
W
NPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSK
DKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCC
A
CPKTEAEKQAEKEEAEYRKVFENFLHNSIFVP
RPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEE
L
ETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPA
EGADDIPGPVTW
E
PRPENSIFLKWPEPENPNGLILMYEIKYGSQVE
DQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSL
S
GNGSWTDPVFFYVQAK
TGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEY
F
SAAD
VYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE
A
SVMKEFNCHHV
VRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIA
D
GMAYLNANKFVHRDLAARNCMVAEDFTVKIG
DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFT
T
YSDV
WSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
E
IISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPG
P
GVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser