NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10139.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10139.1 Public Homo sapiens 15 CYP19A1 22 109 92 CCDS HistoryNCBI Gene:1588Re-query CCDS DB by CCDS ID:10139.1Re-query CCDS DB by GeneID:1588See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10139.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000396402.5 ENSP00000379683.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000396402.5Link to Ensembl Protein Viewer:ENSP00000379683.1Re-query CCDS DB by Nucleotide ID:ENST00000396402Re-query CCDS DB by Protein ID:ENSP00000379683
Original member Current member EBI,WTSI ENST00000396404.8 ENSP00000379685.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000396404.8Link to Ensembl Protein Viewer:ENSP00000379685.4Re-query CCDS DB by Nucleotide ID:ENST00000396404Re-query CCDS DB by Protein ID:ENSP00000379685
Original member Current member EBI,WTSI ENST00000559878.5 ENSP00000453149.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000559878.5Link to Ensembl Protein Viewer:ENSP00000453149.1Re-query CCDS DB by Nucleotide ID:ENST00000559878Re-query CCDS DB by Protein ID:ENSP00000453149
Original member Current member NCBI NM_000103.3 NP_000094.2 Accepted alive Link to Nucleotide Sequence:NM_000103.3Link to Protein Sequence:NP_000094.2Re-query CCDS DB by Nucleotide ID:NM_000103Re-query CCDS DB by Protein ID:NP_000094Link to BLAST:NP_000094.2
Original member Current member NCBI NM_001347248.1 NP_001334177.1 Accepted alive Link to Nucleotide Sequence:NM_001347248.1Link to Protein Sequence:NP_001334177.1Re-query CCDS DB by Nucleotide ID:NM_001347248Re-query CCDS DB by Protein ID:NP_001334177Link to BLAST:NP_001334177.1
Original member Current member NCBI NM_001347249.1 NP_001334178.1 Accepted alive Link to Nucleotide Sequence:NM_001347249.1Link to Protein Sequence:NP_001334178.1Re-query CCDS DB by Nucleotide ID:NM_001347249Re-query CCDS DB by Protein ID:NP_001334178Link to BLAST:NP_001334178.1
Original member Current member NCBI NM_001347250.1 NP_001334179.1 Accepted alive Link to Nucleotide Sequence:NM_001347250.1Link to Protein Sequence:NP_001334179.1Re-query CCDS DB by Nucleotide ID:NM_001347250Re-query CCDS DB by Protein ID:NP_001334179Link to BLAST:NP_001334179.1
Original member Current member NCBI NM_001347251.1 NP_001334180.1 Accepted alive Link to Nucleotide Sequence:NM_001347251.1Link to Protein Sequence:NP_001334180.1Re-query CCDS DB by Nucleotide ID:NM_001347251Re-query CCDS DB by Protein ID:NP_001334180Link to BLAST:NP_001334180.1
Original member Current member NCBI NM_001347252.1 NP_001334181.1 Accepted alive Link to Nucleotide Sequence:NM_001347252.1Link to Protein Sequence:NP_001334181.1Re-query CCDS DB by Nucleotide ID:NM_001347252Re-query CCDS DB by Protein ID:NP_001334181Link to BLAST:NP_001334181.1
Original member Current member NCBI NM_001347253.1 NP_001334182.1 Accepted alive Link to Nucleotide Sequence:NM_001347253.1Link to Protein Sequence:NP_001334182.1Re-query CCDS DB by Nucleotide ID:NM_001347253Re-query CCDS DB by Protein ID:NP_001334182Link to BLAST:NP_001334182.1
Original member Current member NCBI NM_001347254.1 NP_001334183.1 Accepted alive Link to Nucleotide Sequence:NM_001347254.1Link to Protein Sequence:NP_001334183.1Re-query CCDS DB by Nucleotide ID:NM_001347254Re-query CCDS DB by Protein ID:NP_001334183Link to BLAST:NP_001334183.1
Original member Current member NCBI NM_001347255.1 NP_001334184.1 Accepted alive Link to Nucleotide Sequence:NM_001347255.1Link to Protein Sequence:NP_001334184.1Re-query CCDS DB by Nucleotide ID:NM_001347255Re-query CCDS DB by Protein ID:NP_001334184Link to BLAST:NP_001334184.1
Original member Current member NCBI NM_001347256.1 NP_001334185.1 Accepted alive Link to Nucleotide Sequence:NM_001347256.1Link to Protein Sequence:NP_001334185.1Re-query CCDS DB by Nucleotide ID:NM_001347256Re-query CCDS DB by Protein ID:NP_001334185Link to BLAST:NP_001334185.1
Original member Current member NCBI NM_031226.2 NP_112503.1 Accepted alive Link to Nucleotide Sequence:NM_031226.2Link to Protein Sequence:NP_112503.1Re-query CCDS DB by Nucleotide ID:NM_031226Re-query CCDS DB by Protein ID:NP_112503Link to BLAST:NP_112503.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000094.2 503 P11511-1 503 100% 0 0
NP_001334177.1 503 P11511-1 503 100% 0 0
NP_001334178.1 503 P11511-1 503 100% 0 0
NP_001334179.1 503 P11511-1 503 100% 0 0
NP_001334180.1 503 P11511-1 503 100% 0 0
NP_001334181.1 503 P11511-1 503 100% 0 0
NP_001334182.1 503 P11511-1 503 100% 0 0
NP_001334183.1 503 P11511-1 503 100% 0 0
NP_001334184.1 503 P11511-1 503 100% 0 0
NP_001334185.1 503 P11511-1 503 100% 0 0
NP_112503.1 503 P11511-1 503 100% 0 0

Chromosomal Locations for CCDS 10139.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 51210808 51211056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 51212320 51212561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 51215070 51215232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 51215703 51215817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 51218541 51218655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 51222349 51222525 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 51227779 51227933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 51236859 51237009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 51242768 51242912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1512 nt):
ATGGTTTTGGAAATGCTGAACCCGATACATTATAACATCACCAGCATCGTGCCTGAAGCCATGCCTGCTG
CC
ACCATGCCAGTCCTGCTCCTCACTGGCCTTTTTCTCTTGGTGTGGAATTATGAGGGCACATCCTCAAT
A
CCAGGTCCTGGCTACTGCATGGGAATTGGACCCCTCATCTCCCACGGCAGATTCCTGTGGATGGGGATC
GGC
AGTGCCTGCAACTACTACAACCGGGTATATGGAGAATTCATGCGAGTCTGGATCTCTGGAGAGGAAA
CA
CTCATTATCAGCAAGTCCTCAAGTATGTTCCACATAATGAAGCACAATCATTACAGCTCTCGATTCGG
C
AGCAAACTTGGGCTGCAGTGCATCGGTATGCATGAGAAAGGCATCATATTTAACAACAATCCAGAGCTC
TGG
AAAACAACTCGACCCTTCTTTATGAAAGCTCTGTCAGGCCCCGGCCTTGTTCGTATGGTCACAGTCT
GT
GCTGAATCCCTCAAAACACATCTGGACAGGTTGGAGGAGGTGACCAATGAATCGGGCTATGTGGACGT
G
TTGACCCTTCTGCGTCGTGTCATGCTGGACACCTCTAACACGCTCTTCTTGAGGATCCCTTTGGACGAA
AGT
GCTATCGTGGTTAAAATCCAAGGTTATTTTGATGCATGGCAAGCTCTCCTCATCAAACCAGACATCT
TC
TTTAAGATTTCTTGGCTATACAAAAAGTATGAGAAGTCTGTCAAGGATTTGAAAGATGCCATAGAAGT
T
CTGATAGCAGAAAAAAGACGCAGGATTTCCACAGAAGAGAAACTGGAAGAATGTATGGACTTTGCCACT
GAG
TTGATTTTAGCAGAGAAACGTGGTGACCTGACAAGAGAGAATGTGAACCAGTGCATATTGGAAATGC
TG
ATCGCAGCTCCTGACACCATGTCTGTCTCTTTGTTCTTCATGCTATTTCTCATTGCAAAGCACCCTAA
T
GTTGAAGAGGCAATAATAAAGGAAATCCAGACTGTTATTGGTGAGAGAGACATAAAGATTGATGATATA
CAA
AAATTAAAAGTGATGGAAAACTTCATTTATGAGAGCATGCGGTACCAGCCTGTCGTGGACTTGGTCA
TG
CGCAAAGCCTTAGAAGATGATGTAATCGATGGCTACCCAGTGAAAAAGGGGACAAACATTATCCTGAA
T
ATTGGAAGGATGCACAGACTCGAGTTTTTCCCCAAACCCAATGAATTTACTCTTGAAAATTTTGCAAAG
AAT
GTTCCTTATAGGTACTTTCAGCCATTTGGCTTTGGGCCCCGTGGCTGTGCAGGAAAGTACATCGCCA
TG
GTGATGATGAAAGCCATCCTCGTTACACTTCTGAGACGATTCCACGTGAAGACATTGCAAGGACAGTG
T
GTTGAGAGCATACAGAAGATACACGACTTGTCCTTGCACCCAGATGAGACTAAAAACATGCTGGAAATG
ATC
TTTACCCCAAGAAACTCAGACAGGTGTCTGGAACACTAG


Translation (503 aa):
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGI
G
SACNYYNRVYGEFMRVWISGEETLIIS
KSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPEL
W
KTTRPFFMK
ALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDE
S
AIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYEKS
VKDLKDAIEVLIAEKRRRISTEEKLEECMDFAT
E
LILAE
KRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDI
Q
KLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
N
VPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEM
I
FTPRNSDRCLEH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser