NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS73402.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
73402.1 Public Homo sapiens 11 TREH 22 109 92 CCDS HistoryNCBI Gene:11181Re-query CCDS DB by CCDS ID:73402.1Re-query CCDS DB by GeneID:11181See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 73402.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000264029.8 ENSP00000264029.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000264029.8Link to Ensembl Protein Viewer:ENSP00000264029.5Re-query CCDS DB by Nucleotide ID:ENST00000264029Re-query CCDS DB by Protein ID:ENSP00000264029
Original member Current member NCBI NM_007180.2 NP_009111.2 Accepted alive Link to Nucleotide Sequence:NM_007180.2Link to Protein Sequence:NP_009111.2Re-query CCDS DB by Nucleotide ID:NM_007180Re-query CCDS DB by Protein ID:NP_009111Link to BLAST:NP_009111.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_009111.2 583 O43280-1 583 100% 0 0

Chromosomal Locations for CCDS 73402.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 118658289 118658441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118658680 118658733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118658905 118659017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118659370 118659481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118659747 118659964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118660539 118660733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118660866 118660915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118661160 118661282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118661393 118661509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118661637 118661729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118661890 118661990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118662881 118662968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118663052 118663196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118663339 118663439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 118679539 118679627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1752 nt):
ATGCCAGGGAGGACCTGGGAGCTGTGCCTGCTACTGCTGCTGGGGCTGGGACTGGGGTCCCAGGAGGCCC
TA
CCCCCACCCTGTGAGAGTGAGATTTACTGCCACGGGGAGCTCCTAAACCAAGTTCAAATGGCCAAGCT
C
TACCAGGATGACAAGCAGTTTGTGGACATGCCACTGTCTATAGCTCCAGAACAAGTCCTGCAGACCTTC
ACT
GAGCTGTCCAGGGACCACAATCACAGCATCCCCAGGGAGCAGCTGCAGGCGTTTGTCCACGAACACT
TC
CAGGCCAAGGGGCAGGAGCTGCAGCCCTGGACCCCTGCAGACTGGAAAGACAGCCCCCAGTTCCTGCA
G
AAGATTTCAGATGCCAAACTGCGTGCCTGGGCAGGGCAGCTGCATCAGCTCTGGAAGAAGCTGGGGAAG
AAG
ATGAAGCCAGAGGTTCTCAGCCACCCTGAGCGGTTCTCTCTCATCTACTCAGAACATCCCTTCATTG
TG
CCTGGCGGTCGCTTTGTTGAGTTCTACTACTGGGACTCCTACTGGGTCATGGAGGGTCTGCTCCTCTC
A
GAGATGGCTGAGACGGTGAAGGGCATGCTGCAGAACTTCTTGGACCTGGTGAAAACCTATGGGCATGTC
CCC
AATGGTGGGCGCGTGTACTACCTGCAGCGGAGCCAGCCCCCACTCTTGACCCTCATGATGGATTGCT
AC
TTGACTCACACCAATGACACCGCCTTTCTACAGGAAAACATTGAAACACTAGCCTTGGAATTGGACTT
T
TGGACCAAGAACAGGACTGTCTCTGTGAGCTTGGAGGGAAAGAACTACCTCCTGAATCGCTATTATGTC
CCT
TATGGGGGACCCAGGCCTGAGTCCTACAGCAAAGATGTGGAGTTGGCTGACACCTTGCCAGAAGGAG
AC
CGGGAGGCTCTGTGGGCTGAGCTCAAGGCTGGGGCTGAGTCTGGCTGGGACTTCTCTTCACGCTGGCT
C
ATTGGAGGCCCAAACCCCAACTCGCTTAGCGGCATCCGAACAAGCAAACTGGTGCCTGTTGACCTGAAT
GCC
TTCCTATGCCAAGCAGAGGAGCTGATGAGCAACTTCTATTCCAGGCTGGGGAACGACTCCCAGGCCA
CG
AAGTACAGAATCCTGCGGTCGCAGCGCTTGGCCGCCCTGAACACAGTCCTGTGGGATGAGCAGACCGG
A
GCCTGGTTCGATTACGACCTTGAGAAGAAGAAGAAAAACCGGGAGTTTTACCCATCCAACCTCACTCCA
CTC
TGGGCCGGGTGTTTCTCTGACCCTGGCGTGGCGGACAAGGCTCTGAAATACCTGGAGGACAACCGGA
TC
CTGACTTACCAGTATGGGATCCCGACCTCTCTCCAGAAGACAGGCCAGCAGTGGGATTTCCCCAATGC
C
TGGGCCCCCCTGCAGGACCTGGTCATCAGAGGCCTGGCCAAGGCACCTTTACGTCGGGCCCAGGAAGTG
GCT
TTCCAGCTGGCTCAGAATTGGATCCGAACCAATTTTGATGTCTACTCGCAGAAGTCAGCCATGTATG
AG
AAGTATGACGTCAGCAACGGTGGACAGCCCGGTGGGGGAGGAGAATATGAAGTTCAGGAGGGATTTGG
C
TGGACGAATGGCGTGGTCCTGATGCTGCTGGACCGCTATGGTGACCGGCTGACCTCAGGGGCCAAGCTG
GCT
TTCCTGGAGCCCCACTGCCTGGCGGCCACCCTTCTGCCCAGCCTCCTGCTCAGCCTCCTGCCATGGT
GA


Translation (583 aa):
MPGRTWELCLLLLLGLGLGSQEALPPPCESEIYCHGELLNQVQMAKLYQDDKQFVDMPLSIAPEQVLQTF
T
ELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKD
SPQFLQKISDAKLRAWAGQLHQLWKKLGK
K
MKPEVLSHPERFSLIYSEHPFIVPGGRFVEFYYWDSYWVMEGLLLSEMAETVKGMLQNFLDLVKTYGHV
P
NGGRVYYLQRSQPPLLTLMMDCYLTHTNDTAFL
QENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYV
P
YGGP
RPESYSKDVELADTLPEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLN
A
FLCQAEELMSNFYSRL
GNDSQATKYRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTP
L
WAGCFSDPGVADKALKYLE
DNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIRGLAKAPLRRAQEV
A
FQLAQNWIRTNFDVYSQKSAMYEK
YDVSNGGQPGGGGEYEVQEGFGWTNGVVLMLLDRYGDRLTSGAKL
A
FLEPHCLAATLLPSLLLSLLPW




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser