NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6082.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6082.1 Public Homo sapiens 8 WRN 20 108 85 CCDS HistoryNCBI Gene:7486Re-query CCDS DB by CCDS ID:6082.1Re-query CCDS DB by GeneID:7486See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6082.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000298139 ENSP00000298139 Accepted alive Link to Ensembl Transcript Viewer:ENST00000298139Link to Ensembl Protein Viewer:ENSP00000298139Re-query CCDS DB by Nucleotide ID:ENST00000298139Re-query CCDS DB by Protein ID:ENSP00000298139
Original member Current member EBI,WTSI OTTHUMT00000376248 OTTHUMP00000225301 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000376248Link to Vega Protein Viewer:OTTHUMP00000225301Re-query CCDS DB by Nucleotide ID:OTTHUMT00000376248Re-query CCDS DB by Protein ID:OTTHUMP00000225301
Original member Current member NCBI NM_000553.4 NP_000544.2 Accepted alive Link to Nucleotide Sequence:NM_000553.4Link to Protein Sequence:NP_000544.2Re-query CCDS DB by Nucleotide ID:NM_000553Re-query CCDS DB by Protein ID:NP_000544Link to BLink:NP_000544.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000544.2 1432 Q14191 1432 100% 0 0

Chromosomal Locations for CCDS 6082.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 31058448 31058543 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31059153 31059265 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31064289 31064434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31064915 31065063 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31067033 31067182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31068258 31068327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31076173 31076287 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31080867 31081296 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31083699 31083779 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31085166 31085246 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31087776 31087920 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31088890 31088965 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31090465 31090532 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31090834 31090942 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31091830 31091898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31096768 31096850 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31100849 31100955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31111615 31111799 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31116354 31116528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31120243 31120424 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31124522 31124623 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31124908 31125000 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31132365 31132506 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31141430 31141600 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31141681 31141775 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31142626 31142701 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31143550 31143623 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31147053 31147128 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31147364 31147476 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31150341 31150455 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31154624 31154755 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31157368 31157530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31167022 31167230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 31172995 31173102 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4299 nt):
ATGAGTGAAAAAAAATTGGAAACAACTGCACAGCAGCGGAAATGTCCTGAATGGATGAATGTGCAGAATA
AA
AGATGTGCTGTAGAAGAAAGAAAGGCATGTGTTCGGAAGAGTGTTTTTGAAGATGACCTCCCCTTCTT
A
GAATTCACTGGATCCATTGTGTATAGTTACGATGCTAGTGATTGCTCTTTCCTGTCAGAAGATATTAGC
ATG
AGTCTATCAGATGGGGATGTGGTGGGATTTGACATGGAGTGGCCACCATTATACAATAGAGGGAAAC
TT
GGCAAAGTTGCACTAATTCAGTTGTGTGTTTCTGAGAGCAAATGTTACTTGTTCCACGTTTCTTCCAT
G
TCAGTTTTTCCCCAGGGATTAAAAATGTTGCTTGAAAATAAAGCAGTTAAAAAGGCAGGTGTAGGAATT
GAA
GGAGATCAGTGGAAACTTCTACGTGACTTTGATATCAAATTGAAGAATTTTGTGGAGTTGACAGATG
TT
GCCAATAAAAAGCTGAAATGCACAGAGACCTGGAGCCTTAACAGTCTGGTTAAACACCTCTTAGGTAA
A
CAGCTCCTGAAAGACAAGTCTATCCGCTGTAGCAATTGGAGTAAATTTCCTCTCACTGAGGACCAGAAA
CTG
TATGCAGCCACTGATGCTTATGCTGGTTTTATTATTTACCGAAATTTAGAGATTTTGGATGATACTG
TG
CAAAGGTTTGCTATAAATAAAGAGGAAGAAATCCTACTTAGCGACATGAACAAACAGTTGACTTCAAT
C
TCTGAGGAAGTGATGGATCTGGCTAAGCATCTTCCTCATGCTTTCAGTAAATTGGAAAACCCACGGAGG
GTT
TCTATCTTACTAAAGGATATTTCAGAAAATCTATATTCACTGAGGAGGATGATAATTGGGTCTACTA
AC
ATTGAGACTGAACTGAGGCCCAGCAATAATTTAAACTTATTATCCTTTGAAGATTCAACTACTGGGGG
A
GTACAACAGAAACAAATTAGAGAACATGAAGTTTTAATTCACGTTGAAGATGAAACATGGGACCCAACA
CTT
GATCATTTAGCTAAACATGATGGAGAAGATGTACTTGGAAATAAAGTGGAACGAAAAGAAGATGGAT
TT
GAAGATGGAGTAGAAGACAACAAATTGAAAGAGAATATGGAAAGAGCTTGTTTGATGTCGTTAGATAT
T
ACAGAACATGAACTCCAAATTTTGGAACAGCAGTCTCAGGAAGAATATCTTAGTGATATTGCTTATAAA
TCT
ACTGAGCATTTATCTCCCAATGATAATGAAAACGATACGTCCTATGTAATTGAGAGTGATGAAGATT
TA
GAAATGGAGATGCTTAAGCATTTATCTCCCAATGATAATGAAAACGATACGTCCTATGTAATTGAGAG
T
GATGAAGATTTAGAAATGGAGATGCTTAAGTCTTTAGAAAACCTCAATAGTGGCACGGTAGAACCAACT
CAT
TCTAAATGCTTAAAAATGGAAAGAAATCTGGGTCTTCCTACTAAAGAAGAAGAAGAAGATGATGAAA
AT
GAAGCTAATGAAGGGGAAGAAGATGATGATAAGGACTTTTTGTGGCCAGCACCCAATGAAGAGCAAGT
T
ACTTGCCTCAAGATGTACTTTGGCCATTCCAGTTTTAAACCAGTTCAGTGGAAAGTGATTCATTCAGTA
TTA
GAAGAAAGAAGAGATAATGTTGCTGTCATGGCAACTGGATATGGAAAGAGTTTGTGCTTCCAGTATC
CA
CCTGTTTATGTAGGCAAGATTGGCCTTGTTATCTCTCCCCTTATTTCTCTGATGGAAGACCAAGTGCT
A
CAGCTTAAAATGTCCAACATCCCAGCTTGCTTCCTTGGATCAGCACAGTCAGAAAATGTTCTAACAGAT
ATT
AAATTAGGTAAATACCGGATTGTATACGTAACTCCAGAATACTGTTCAGGTAACATGGGCCTGCTCC
AG
CAACTTGAGGCTGATATTGGTATCACGCTCATTGCTGTGGATGAGGCTCACTGTATTTCTGAGTGGGG
G
CATGATTTTAGGGATTCATTCAGGAAGTTGGGCTCCCTAAAGACAGCACTGCCAATGGTTCCAATCGTT
GCA
CTTACTGCTACTGCAAGTTCTTCAATCCGGGAAGACATTGTACGTTGCTTAAATCTGAGAAATCCTC
AG
ATCACCTGTACTGGTTTTGATCGACCAAACCTGTATTTAGAAGTTAGGCGAAAAACAGGGAATATCCT
T
CAGGATCTGCAGCCATTTCTTGTCAAAACAAGTTCCCACTGGGAATTTGAAGGTCCAACAATCATCTAC
TGT
CCTTCTAGAAAAATGACACAACAAGTTACAGGTGAACTTAGGAAACTGAATCTATCCTGTGGAACAT
AC
CATGCGGGCATGAGTTTTAGCACAAGGAAAGACATTCATCATAGGTTTGTAAGAGATGAAATTCAGTG
T
GTCATAGCTACCATAGCTTTTGGAATGGGCATTAATAAAGCTGACATTCGCCAAGTCATTCATTACGGT
GCT
CCTAAGGACATGGAATCATATTATCAGGAGATTGGTAGAGCTGGTCGTGATGGACTTCAAAGTTCTT
GT
CACGTCCTCTGGGCTCCTGCAGACATTAACTTAAATAGGCACCTTCTTACTGAGATACGTAATGAGAA
G
TTTCGATTATACAAATTAAAGATGATGGCAAAGATGGAAAAATATCTTCATTCTAGCAGATGTAGGAGA
CA
A
ATCATCTTGTCTCATTTTGAGGACAAACAAGTACAAAAAGCCTCCTTGGGAATTATGGGAACTGAAA
AA
TGCTGTGATAATTGCAGGTCCAGATTGGATCATTGCTATTCCATGGATGACTCAGAGGATACATCCTG
G
GACTTTGGTCCACAAGCATTTAAGCTTTTGTCTGCTGTGGACATCTTAGGCGAAAAATTTGGAATTGGG
CTT
CCAATTTTATTTCTCCGAGGATCTAATTCTCAGCGTCTTGCCGATCAATATCGCAGGCACAGTTTAT
TT
GGCACTGGCAAGGATCAAACAGAGAGTTGGTGGAAGGCTTTTTCCCGTCAGCTGATCACTGAGGGATT
C
TTGGTAGAAGTTTCTCGGTATAACAAATTTATGAAGATTTGCGCCCTTACGAAAAAGGGTAGAAATTGG
CTT
CATAAAGCTAATACAGAATCTCAGAGCCTCATCCTTCAAGCTAATGAAGAATTGTGTCCAAAGAAGT
TG
CTTCTGCCTAGTTCGAAAACTGTATCTTCGGGCACCAAAGAGCATTGTTATAATCAAGTACCAGTTGA
A
TTAAGTACAGAGAAGAAGTCTAACTTGGAGAAGTTATATTCTTATAAACCATGTGATAAGATTTCTTCT
GGG
AGTAACATTTCTAAAAAAAGTATCATGGTACAGTCACCAGAAAAAGCTTACAGTTCCTCACAGCCTG
TT
ATTTCGGCACAAGAGCAGGAGACTCAGATTGTGTTATATGGCAAATTGGTAGAAGCTAGGCAGAAACA
T
GCCAATAAAATGGATGTTCCCCCAGCTATTCTGGCAACAAACAAGATACTGGTGGATATGGCCAAAATG
AG
A
CCAACTACGGTTGAAAACGTAAAAAGGATTGATGGTGTTTCTGAAGGCAAAGCTGCCATGTTGGCCC
CT
CTGTTGGAAGTCATCAAACATTTCTGCCAAACAAATAGTGTTCAGACAGACCTCTTTTCAAGTACAAA
A
CCTCAAGAAGAACAGAAGACGAGTCTGGTAGCAAAAAATAAAATATGCACACTTTCACAGTCTATGGCC
ATC
ACATACTCTTTATTCCAAGAAAAGAAGATGCCTTTGAAGAGCATAGCTGAGAGCAGGATTCTGCCTC
TC
ATGACAATTGGCATGCACTTATCCCAAGCGGTGAAAGCTGGCTGCCCCCTTGATTTGGAGCGAGCAGG
C
CTGACTCCAGAGGTTCAGAAGATTATTGCTGATGTTATCCGAAACCCTCCCGTCAACTCAGATATGAGT
AAA
ATTAGCCTAATCAGAATGTTAGTTCCTGAAAACATTGACACGTACCTTATCCACATGGCAATTGAGA
TC
CTTAAACATGGTCCTGACAGCGGACTTCAACCTTCATGTGATGTCAACAAAAGGAGATGTTTTCCCGG
T
TCTGAAGAGATCTGTTCAAGTTCTAAGAGAAGCAAGGAAGAAGTAGGCATCAATACTGAGACTTCATCT
GCA
GAGAGAAAGAGACGATTACCTGTGTGGTTTGCCAAAGGAAGTGATACCAGCAAGAAATTAATGGACA
AA
ACGAAAAGGGGAGGTCTTTTTAGTTAA


Translation (1432 aa):
MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDIS
M
SLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMS
VFPQGLKMLLENKAVKKAGVGI
E
GDQWKLLRDFDIKLKNFVELTDVANKK
LKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQK
L
YAATDAY
AGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRR
V
SILLKDISENLYSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPT
L
DHLAKHDGEDVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYK
S
TE
HLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLENLNSGTVEPT
H
SKCLKMERNLGLPTKEEEEDDENEANEGEEDDDK
DFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHSV
L
EERRDNVAVMAT
GYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTD
I
K
LGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIV
A
LTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKT
SSHWEFEGPTIIY
C
PSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQ
CVIATIAFGMGINKADIRQVIHYG
A
PKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLN
RHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRR
Q
IILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFGPQAFKLLSAVDILGEKFGIG
L
PILFLRGS
NSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNW
L
HKANTESQSLILQANEELCPKKLLLP
SSKTVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISS
G
SNISKK
SIMVQSPEKAYSSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKM
R
PTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMA
I
TYSLFQEKKMPL
KSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMS
K
ISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTE
TSS
A
ERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser