NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS43582.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43582.1 Public Homo sapiens 7 GRB10 22 109 92 CCDS HistoryNCBI Gene:2887Re-query CCDS DB by CCDS ID:43582.1Re-query CCDS DB by GeneID:2887See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 43582.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000398812.6 ENSP00000381793.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000398812.6Link to Ensembl Protein Viewer:ENSP00000381793.2Re-query CCDS DB by Nucleotide ID:ENST00000398812Re-query CCDS DB by Protein ID:ENSP00000381793
Original member Current member EBI,WTSI ENST00000401949.5 ENSP00000385770.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000401949.5Link to Ensembl Protein Viewer:ENSP00000385770.1Re-query CCDS DB by Nucleotide ID:ENST00000401949Re-query CCDS DB by Protein ID:ENSP00000385770
Original member Current member NCBI NM_001350814.1 NP_001337743.1 Accepted alive Link to Nucleotide Sequence:NM_001350814.1Link to Protein Sequence:NP_001337743.1Re-query CCDS DB by Nucleotide ID:NM_001350814Re-query CCDS DB by Protein ID:NP_001337743Link to BLAST:NP_001337743.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001337743.1 594 Q13322-1 594 100% 0 0

Chromosomal Locations for CCDS 43582.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 50592952 50593098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50595437 50595530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50603998 50604085 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50604311 50604377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50605290 50605406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50606337 50606414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50612741 50612839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50614770 50614880 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50616210 50616347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50618071 50618139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50619170 50619285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50626822 50626978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50669722 50669863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50674436 50674658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50703821 50703908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 50732272 50732322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1785 nt):
ATGGCTTTAGCCGGCTGCCCAGATTCCTTTTTGCACCATCCGTACTACCAGGACAAGGTGGAGCAGACAC
CT
CGCAGTCAACAAGACCCGGCAGGACCAGGACTCCCCGCACAGTCTGACCGACTTGCGAATCACCAGGA
G
GATGATGTGGACCTGGAAGCCCTGGTGAACGATATGAATGCATCCCTGGAGAGCCTGTACTCGGCCTGC
AGC
ATGCAGTCAGACACGGTGCCCCTCCTGCAGAATGGCCAGCATGCCCGCAGCCAGCCTCGGGCTTCAG
GC
CCTCCTCGGTCCATCCAGCCACAGGTGTCCCCGAGGCAGAGGGTGCAGCGCTCCCAGCCTGTGCACAT
C
CTCGCTGTCAGGCGCCTTCAGGAGGAAGACCAGCAGTTTAGAACCTCATCTCTGCCGGCCATCCCCAAT
CCT
TTTCCTGAACTCTGTGGCCCTGGGAGCCCCCCTGTGCTCACGCCGGGTTCTTTACCTCCGAGCCAGG
CC
GCCGCAAAGCAGGATGTTAAAGTCTTTAGTGAAGATGGGACAAGCAAAGTGGTGGAGATTCTAGCAGA
C
ATGACAGCCAGAGACCTGTGCCAATTGCTGGTTTACAAAAGTCACTGTGTGGATGACAACAGCTGGACA
CTA
GTGGAGCACCACCCGCACCTAGGATTAGAGAGGTGCTTGGAAGACCATGAGCTGGTGGTCCAGGTGG
AG
AGTACCATGGCCAGTGAGAGTAAATTTCTATTCAGGAAGAATTACGCAAAATACGAGTTCTTTAAAAA
T
CCCATGAATTTCTTCCCAGAACAGATGGTTACTTGGTGCCAGCAGTCAAATGGCAGTCAAACCCAGCTT
TTG
CAGAATTTTCTGAACTCCAGTAGTTGTCCTGAAATTCAAGGGTTTTTGCATGTGAAAGAGCTGGGAA
AG
AAATCATGGAAAAAGCTGTATGTGTGTTTGCGGAGATCTGGCCTTTATTGCTCCACCAAGGGAACTTC
A
AAGGAACCCAGACACCTGCAGCTGCTGGCCGACCTGGAGGACAGCAACATCTTCTCCCTGATCGCTGGC
AGG
AAGCAGTACAACGCCCCTACAGACCACGGGCTCTGCATAAAGCCAAACAAAGTCAGGAATGAAACTA
AA
GAGCTGAGGTTGCTCTGTGCAGAGGACGAGCAAACCAGGACGTGCTGGATGACAGCGTTCAGACTCCT
C
AAGTATGGAATGCTCCTTTACCAGAATTACCGAATCCCTCAGCAGAGGAAGGCCTTGCTGTCCCCGTTC
TCG
ACGCCAGTGCGCAGTGTCTCCGAGAACTCCCTCGTGGCAATGGATTTTTCTGGGCAAACAGGACGCG
TG
ATAGAGAATCCGGCAGAGGCCCAGAGCGCAGCCCTGGAGGAGGGCCACGCCTGGAGGAAGCGAAGCAC
A
CGGATGAACATCCTAGGTAGCCAAAGTCCCCTCCACCCTTCTACCCTAAGTACAGTGATTCACAGGACA
CAG
CACTGGTTTCACGGGAGGATCTCCAGGGAGGAATCCCACAGGATCATTAAACAGCAAGGGCTCGTGG
AT
GGGCTTTTTCTCCTCCGTGACAGCCAGAGTAATCCAAAGGCATTTGTACTCACACTGTGTCATCACCA
G
AAAATTAAAAATTTCCAGATCTTACCTTGCGAGGACGACGGGCAGACGTTCTTCAGCCTAGATGACGGG
AAC
ACCAAATTCTCTGACCTGATCCAGCTGGTTGACTTTTACCAGCTGAACAAAGGAGTCCTGCCTTGCA
AA
CTCAAGCACCACTGCATCCGAGTGGCCTTATGA


Translation (594 aa):
MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSAC
S
MQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAV
RRLQEEDQQFRTSSLPAIPN
P
FPELCGPGSPPVLTPGSLPPSQAAAKQ
DVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNSWT
L
VEHHPHLGL
ERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQL
L
Q
NFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAG
R
KQYNAPTDHGLCIK
PNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPF
S
TPV
RSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRT
Q
HWFHGRISREESHRIIKQQGLVD
GLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDG
N
TKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser