NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS42544.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42544.1 Public Homo sapiens 19 PEPD 20 108 85 CCDS HistoryNCBI Gene:5184Re-query CCDS DB by CCDS ID:42544.1Re-query CCDS DB by GeneID:5184See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 42544.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000244137 ENSP00000244137 Accepted alive Link to Ensembl Transcript Viewer:ENST00000244137Link to Ensembl Protein Viewer:ENSP00000244137Re-query CCDS DB by Nucleotide ID:ENST00000244137Re-query CCDS DB by Protein ID:ENSP00000244137
Original member Current member EBI,WTSI OTTHUMT00000451432 OTTHUMP00000264333 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000451432Link to Vega Protein Viewer:OTTHUMP00000264333Re-query CCDS DB by Nucleotide ID:OTTHUMT00000451432Re-query CCDS DB by Protein ID:OTTHUMP00000264333
Original member Current member NCBI NM_000285.3 NP_000276.2 Accepted alive Link to Nucleotide Sequence:NM_000285.3Link to Protein Sequence:NP_000276.2Re-query CCDS DB by Nucleotide ID:NM_000285Re-query CCDS DB by Protein ID:NP_000276Link to BLink:NP_000276.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000276.2 493 P12955-1 493 100% 0 0

Chromosomal Locations for CCDS 42544.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 33387344 33387481 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33387890 33388081 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33391295 33391479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33401721 33401869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33411672 33411749 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33413575 33413643 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33462995 33463041 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33463987 33464062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33478046 33478090 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33489996 33490057 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33493290 33493337 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33500938 33501001 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33511028 33511155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33512593 33512776 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 33521744 33521760 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1482 nt):
ATGGCGGCGGCCACCGGACCCTCGTTTTGGCTGGGGAATGAAACCCTGAAGGTGCCGCTGGCGCTCTTTG
CC
TTGAACCGGCAGCGCCTGTGTGAGCGGCTGCGGAAGAACCCTGCTGTGCAGGCCGGCTCCATCGTGGT
C
CTGCAGGGCGGGGAGGAGACTCAGCGCTACTGCACCGACACCGGGGTCCTCTTCCGCCAGGAGTCCTTC
TTT
CACTGGGCGTTCGGTGTCACTGAGCCAGGCTGCTATGGTGTCATCGATGTTGACACTGGGAAGTCGA
CC
CTGTTTGTGCCCAGGCTTCCTGCCAGCCATGCCACCTGGATGGGAAAGATCCATTCCAAGGAGCACTT
C
AAGGAGAAGTATGCCGTGGACGACGTCCAGTACGTAGATGAGATTGCCAGCGTCCTGACGTCACAGAAG
CCC
TCTGTCCTCCTCACTTTGCGTGGCGTCAACACGGACAGCGGCAGTGTCTGCAGGGAGGCCTCCTTTG
AC
GGCATCAGCAAGTTCGAAGTCAACAATACCATTCTTCACCCAGAGATCGTTGAGTGCCGAGTGTTTAA
G
ACGGATATGGAGCTGGAGGTTCTGCGCTATACCAATAAAATCTCCAGCGAGGCCCACCGTGAGGTAATG
AAG
GCTGTAAAAGTGGGAATGAAAGAATATGAGTTGGAAAGCCTCTTCGAGCACTACTGCTACTCCCGGG
GC
GGCATGCGCCACAGCTCCTACACCTGCATCTGCGGCAGTGGTGAGAACTCAGCCGTGCTACACTACGG
A
CACGCCGGAGCTCCCAACGACCGAACGATCCAGAATGGGGATATGTGCCTGTTCGACATGGGCGGTGAG
TAT
TACTGCTTCGCTTCCGACATCACCTGCTCCTTTCCCGCCAACGGCAAGTTCACTGCAGACCAGAAGG
CC
GTCTATGAGGCAGTGCTGCGGAGCTCCCGTGCCGTCATGGGTGCCATGAAGCCAGGTGTCTGGTGGCC
T
GACATGCACCGCCTGGCTGACCGCATCCACCTGGAGGAGCTGGCCCACATGGGCATCCTGAGCGGCAGC
GTG
GACGCCATGGTCCAGGCTCACCTGGGGGCCGTGTTTATGCCTCACGGGCTTGGCCACTTCCTGGGCA
TT
GACGTGCACGACGTGGGAGGCTACCCAGAGGGCGTGGAGCGCATCGACGAGCCCGGCCTGCGGAGCCT
G
CGCACTGCACGGCACCTGCAGCCAGGCATGGTGCTCACCGTGGAGCCGGGCATCTACTTCATCGACCAC
CTC
CTGGATGAGGCCCTGGCGGACCCGGCCCGCGCCTCCTTCCTTAACCGCGAGGTCCTGCAGCGCTTTC
GC
GGTTTTGGCGGGGTCCGCATCGAGGAGGACGTCGTGGTGACTGACAGCGGCATAGAGCTGCTGACCTG
C
GTGCCCCGCACTGTGGAAGAGATTGAAGCATGCATGGCAGGCTGTGACAAGGCCTTTACCCCCTTCTCT
GGC
CCCAAGTAG


Translation (493 aa):
MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESF
F
HWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMG
KIHSKEHFKEKYAVDDVQYVDEIASVLTSQK
P
SVLLTL
RGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVM
K
AVKVGMKEYELE
SLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGE
Y
YCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKP
GVWWPDMHRLADRIHLEELAHMGILSGS
V
DAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPE
GVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH
L
LDEALADPARASFLNREVLQRFRGFGG
VRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFS
G
PK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser