NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3787.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3787.1 Public Homo sapiens 4 FGA 20 108 85 CCDS HistoryNCBI Gene:2243Re-query CCDS DB by CCDS ID:3787.1Re-query CCDS DB by GeneID:2243See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3787.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000302053 ENSP00000306361 Accepted alive Link to Ensembl Transcript Viewer:ENST00000302053Link to Ensembl Protein Viewer:ENSP00000306361Re-query CCDS DB by Nucleotide ID:ENST00000302053Re-query CCDS DB by Protein ID:ENSP00000306361
Original member Current member EBI,WTSI OTTHUMT00000317593 OTTHUMP00000197064 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000317593Link to Vega Protein Viewer:OTTHUMP00000197064Re-query CCDS DB by Nucleotide ID:OTTHUMT00000317593Re-query CCDS DB by Protein ID:OTTHUMP00000197064
Original member Current member NCBI NM_000508.4 NP_000499.1 Accepted alive Link to Nucleotide Sequence:NM_000508.4Link to Protein Sequence:NP_000499.1Re-query CCDS DB by Nucleotide ID:NM_000508Re-query CCDS DB by Protein ID:NP_000499Link to BLink:NP_000499.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000499.1 866 P02671-1 866 100% 0 0

Chromosomal Locations for CCDS 3787.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 154584124 154584833 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154585538 154586918 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154587512 154587657 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154588793 154588976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154589437 154589562 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 154590634 154590687 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2601 nt):
ATGTTTTCCATGAGGATCGTCTGCCTGGTCCTAAGTGTGGTGGGCACAGCATGGACTGCAGATAGTGGTG
AA
GGTGACTTTCTAGCTGAAGGAGGAGGCGTGCGTGGCCCAAGGGTTGTGGAAAGACATCAATCTGCCTG
C
AAAGATTCAGACTGGCCCTTCTGCTCTGATGAAGACTGGAACTACAAATGCCCTTCTGGCTGCAGGATG
AAA
GGGTTGATTGATGAAGTCAATCAAGATTTTACAAACAGAATAAATAAGCTCAAAAATTCACTATTTG
AA
TATCAGAAGAACAATAAGGATTCTCATTCGTTGACCACTAATATAATGGAAATTTTGAGAGGCGATTT
T
TCCTCAGCCAATAACCGTGATAATACCTACAACCGAGTGTCAGAGGATCTGAGAAGCAGAATTGAAGTC
CTG
AAGCGCAAAGTCATAGAAAAAGTACAGCATATCCAGCTTCTGCAGAAAAATGTTAGAGCTCAGTTGG
TT
GATATGAAACGACTGGAGGTGGACATTGATATTAAGATCCGATCTTGTCGAGGGTCATGCAGTAGGGC
T
TTAGCTCGTGAAGTAGATCTGAAGGACTATGAAGATCAGCAGAAGCAACTTGAACAGGTCATTGCCAAA
GAC
TTACTTCCCTCTAGAGATAGGCAACACTTACCACTGATAAAAATGAAACCAGTTCCAGACTTGGTTC
CC
GGAAATTTTAAGAGCCAGCTTCAGAAGGTACCCCCAGAGTGGAAGGCATTAACAGACATGCCGCAGAT
G
AGAATGGAGTTAGAGAGACCTGGTGGAAATGAGATTACTCGAGGAGGCTCCACCTCTTATGGAACCGGA
TCA
GAGACGGAAAGCCCCAGGAACCCTAGCAGTGCTGGAAGCTGGAACTCTGGGAGCTCTGGACCTGGAA
GT
ACTGGAAACCGAAACCCTGGGAGCTCTGGGACTGGAGGGACTGCAACCTGGAAACCTGGGAGCTCTGG
A
CCTGGAAGTACTGGAAGCTGGAACTCTGGGAGCTCTGGAACTGGAAGTACTGGAAACCAAAACCCTGGG
AGC
CCTAGACCTGGTAGTACCGGAACCTGGAATCCTGGCAGCTCTGAACGCGGAAGTGCTGGGCACTGGA
CC
TCTGAGAGCTCTGTATCTGGTAGTACTGGACAATGGCACTCTGAATCTGGAAGTTTTAGGCCAGATAG
C
CCAGGCTCTGGGAACGCGAGGCCTAACAACCCAGACTGGGGCACATTTGAAGAGGTGTCAGGAAATGTA
AGT
CCAGGGACAAGGAGAGAGTACCACACAGAAAAACTGGTCACTTCTAAAGGAGATAAAGAGCTCAGGA
CT
GGTAAAGAGAAGGTCACCTCTGGTAGCACAACCACCACGCGTCGTTCATGCTCTAAAACCGTTACTAA
G
ACTGTTATTGGTCCTGATGGTCACAAAGAAGTTACCAAAGAAGTGGTGACCTCCGAAGATGGTTCTGAC
TGT
CCCGAGGCAATGGATTTAGGCACATTGTCTGGCATAGGTACTCTGGATGGGTTCCGCCATAGGCACC
CT
GATGAAGCTGCCTTCTTCGACACTGCCTCAACTGGAAAAACATTCCCAGGTTTCTTCTCACCTATGTT
A
GGAGAGTTTGTCAGTGAGACTGAGTCTAGGGGCTCAGAATCTGGCATCTTCACAAATACAAAGGAATCC
AGT
TCTCATCACCCTGGGATAGCTGAATTCCCTTCCCGTGGTAAATCTTCAAGTTACAGCAAACAATTTA
CT
AGTAGCACGAGTTACAACAGAGGAGACTCCACATTTGAAAGCAAGAGCTATAAAATGGCAGATGAGGC
C
GGAAGTGAAGCCGATCATGAAGGAACACATAGCACCAAGAGAGGCCATGCTAAATCTCGCCCTGTCAGA
G
AC
TGTGATGATGTCCTCCAAACACATCCTTCAGGTACCCAAAGTGGCATTTTCAATATCAAGCTACCGG
GA
TCCAGTAAGATTTTTTCTGTTTATTGCGATCAAGAGACCAGTTTGGGAGGATGGCTTTTGATCCAGCA
A
AGAATGGATGGATCACTGAATTTTAACCGGACCTGGCAAGACTACAAGAGAGGTTTCGGCAGCCTGAAT
GAC
GAGGGGGAAGGAGAATTCTGGCTAGGCAATGACTACCTCCACTTACTAACCCAAAGGGGCTCTGTTC
TT
AGGGTTGAATTAGAGGACTGGGCTGGGAATGAAGCTTATGCAGAATATCACTTCCGGGTAGGCTCTGA
G
GCTGAAGGCTATGCCCTCCAAGTCTCCTCCTATGAAGGCACTGCGGGTGATGCTCTGATTGAGGGTTCC
GTA
GAGGAAGGGGCAGAGTACACCTCTCACAACAACATGCAGTTCAGCACCTTTGACAGGGATGCAGACC
AG
TGGGAAGAGAACTGTGCAGAAGTCTATGGGGGAGGCTGGTGGTATAATAACTGCCAAGCAGCCAATCT
C
AATGGAATCTACTACCCTGGGGGCTCCTATGACCCAAGGAATAACAGTCCTTATGAGATTGAGAATGGA
GTG
GTCTGGGTTTCCTTTAGAGGGGCAGATTATTCCCTCAGGGCTGTTCGCATGAAAATTAGGCCCCTTG
TG
ACCCAATAG


Translation (866 aa):
MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDWNYKCPSGCRM
K
GLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSAN
NRDNTYNRVSEDLRSRIEV
L
KRKVIEKVQHIQLLQKNVRAQLVDMKRLE
VDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAK
D
LLPSRDRQHLPLIKMKPVPDLVPGNFKSQLQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTG
S
ETESPRNPSSAGSWNSGSSGPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPG
S
PRPGSTGTWNPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV
S
PGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSD
C
PEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEFVSETESRGSESGIFTNTKES
S
SHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAKSRPVR

D
CDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLN
D
EGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGS
V
EEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG
V
VWVSFRGADYSLRAVRMKIRPLVTQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser