NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS1825.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1825.1 Public Homo sapiens 2 EPAS1 20 108 85 CCDS HistoryNCBI Gene:2034Re-query CCDS DB by CCDS ID:1825.1Re-query CCDS DB by GeneID:2034See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1825.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000263734 ENSP00000263734 Accepted alive Link to Ensembl Transcript Viewer:ENST00000263734Link to Ensembl Protein Viewer:ENSP00000263734Re-query CCDS DB by Nucleotide ID:ENST00000263734Re-query CCDS DB by Protein ID:ENSP00000263734
Original member Current member EBI,WTSI OTTHUMT00000250752 OTTHUMP00000159033 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000250752Link to Vega Protein Viewer:OTTHUMP00000159033Re-query CCDS DB by Nucleotide ID:OTTHUMT00000250752Re-query CCDS DB by Protein ID:OTTHUMP00000159033
Original member Current member NCBI NM_001430.4 NP_001421.2 Accepted alive Link to Nucleotide Sequence:NM_001430.4Link to Protein Sequence:NP_001421.2Re-query CCDS DB by Nucleotide ID:NM_001430Re-query CCDS DB by Protein ID:NP_001421Link to BLink:NP_001421.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001421.2 870 Q99814 870 100% 0 0

Chromosomal Locations for CCDS 1825.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 46297912 46297937 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46346873 46347063 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46356151 46356302 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46356724 46356808 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46360638 46360756 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46360885 46361090 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46369827 46369933 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46375690 46375837 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46376539 46376753 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46377894 46378087 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46378657 46378767 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46380227 46380717 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46381596 46381722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46381975 46382089 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46382425 46382598 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 46384509 46384660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2613 nt):
ATGACAGCTGACAAGGAGAAGAAAAGGAGTAGCTCGGAGAGGAGGAAGGAGAAGTCCCGGGATGCTGCGC
GG
TGCCGGCGGAGCAAGGAGACGGAGGTGTTCTATGAGCTGGCCCATGAGCTGCCTCTGCCCCACAGTGT
G
AGCTCCCATCTGGACAAGGCCTCCATCATGCGACTGGCAATCAGCTTCCTGCGAACACACAAGCTCCTC
TCC
TCAGTTTGCTCTGAAAACGAGTCCGAAGCCGAAGCTGACCAGCAGATGGACAACTTGTACCTGAAAG
CC
TTGGAGGGTTTCATTGCCGTGGTGACCCAAGATGGCGACATGATCTTTCTGTCAGAAAACATCAGCAA
G
TTCATGGGACTTACACAGGTGGAGCTAACAGGACATAGTATCTTTGACTTCACTCATCCCTGCGACCAT
GAG
GAGATTCGTGAGAACCTGAGTCTCAAAAATGGCTCTGGTTTTGGGAAAAAAAGCAAAGACATGTCCA
CA
GAGCGGGACTTCTTCATGAGGATGAAGTGCACGGTCACCAACAGAGGCCGTACTGTCAACCTCAAGTC
A
GCCACCTGGAAGGTCTTGCACTGCACGGGCCAGGTGAAAGTCTACAACAACTGCCCTCCTCACAATAGT
CTG
TGTGGCTACAAGGAGCCCCTGCTGTCCTGCCTCATCATCATGTGTGAACCAATCCAGCACCCATCCC
AC
ATGGACATCCCCCTGGATAGCAAGACCTTCCTGAGCCGCCACAGCATGGACATGAAGTTCACCTACTG
T
GATGACAGAATCACAGAACTGATTGGTTACCACCCTGAGGAGCTGCTTGGCCGCTCAGCCTATGAATTC
TAC
CATGCGCTAGACTCCGAGAACATGACCAAGAGTCACCAGAACTTGTGCACCAAGGGTCAGGTAGTAA
GT
GGCCAGTACCGGATGCTCGCAAAGCATGGGGGCTACGTGTGGCTGGAGACCCAGGGGACGGTCATCTA
C
AACCCTCGCAACCTGCAGCCCCAGTGCATCATGTGTGTCAACTACGTCCTGAGTGAGATTGAGAAGAAT
GAC
GTGGTGTTCTCCATGGACCAGACTGAATCCCTGTTCAAGCCCCACCTGATGGCCATGAACAGCATCT
TT
GATAGCAGTGGCAAGGGGGCTGTGTCTGAGAAGAGTAACTTCCTATTCACCAAGCTAAAGGAGGAGCC
C
GAGGAGCTGGCCCAGCTGGCTCCCACCCCAGGAGACGCCATCATCTCTCTGGATTTCGGGAATCAGAAC
TTC
GAGGAGTCCTCAGCCTATGGCAAGGCCATCCTGCCCCCGAGCCAGCCATGGGCCACGGAGTTGAGGA
GC
CACAGCACCCAGAGCGAGGCTGGGAGCCTGCCTGCCTTCACCGTGCCCCAGGCAGCTGCCCCGGGCAG
C
ACCACCCCCAGTGCCACCAGCAGCAGCAGCAGCTGCTCCACGCCCAATAGCCCTGAAGACTATTACACA
TCT
TTGGATAACGACCTGAAGATTGAAGTGATTGAGAAGCTCTTCGCCATGGACACAGAGGCCAAGGACC
AA
TGCAGTACCCAGACGGATTTCAATGAGCTGGACTTGGAGACACTGGCACCCTATATCCCCATGGACGG
G
GAAGACTTCCAGCTAAGCCCCATCTGCCCCGAGGAGCGGCTCTTGGCGGAGAACCCACAGTCCACCCCC
CAG
CACTGCTTCAGTGCCATGACAAACATCTTCCAGCCACTGGCCCCTGTAGCCCCGCACAGTCCCTTCC
TC
CTGGACAAGTTTCAGCAGCAGCTGGAGAGCAAGAAGACAGAGCCCGAGCACCGGCCCATGTCCTCCAT
C
TTCTTTGATGCCGGAAGCAAAGCATCCCTGCCACCGTGCTGTGGCCAGGCCAGCACCCCTCTCTCTTCC
ATG
GGGGGCAGATCCAATACCCAGTGGCCCCCAGATCCACCATTACATTTTGGGCCCACAAAGTGGGCCG
TC
GGGGATCAGCGCACAGAGTTCTTGGGAGCAGCGCCGTTGGGGCCCCCTGTCTCTCCACCCCATGTCTC
C
ACCTTCAAGACAAGGTCTGCAAAGGGTTTTGGGGCTCGAGGCCCAGACGTGCTGAGTCCGGCCATGGTA
GCC
CTCTCCAACAAGCTGAAGCTGAAGCGACAGCTGGAGTATGAAGAGCAAGCCTTCCAGGACCTGAGCG
GG
GGGGACCCACCTGGTGGCAGCACCTCACATTTGATGTGGAAACGGATGAAGAACCTCAGGGGTGGGAG
C
TGCCCTTTGATGCCGGACAAGCCACTGAGCGCAAATGTACCCAATGATAAGTTCACCCAAAACCCCATG
AGG
GGCCTGGGCCATCCCCTGAGACATCTGCCGCTGCCACAGCCTCCATCTGCCATCAGTCCCGGGGAGA
AC
AGCAAGAGCAGGTTCCCCCCACAGTGCTACGCCACCCAGTACCAGGACTACAGCCTGTCGTCAGCCCA
C
AAGGTGTCAGGCATGGCAAGCCGGCTGCTCGGGCCCTCATTTGAGTCCTACCTGCTGCCCGAACTGACC
AGA
TATGACTGTGAGGTGAACGTGCCCGTGCTGGGAAGCTCCACGCTCCTGCAAGGAGGGGACCTCCTCA
GA
GCCCTGGACCAGGCCACCTGA


Translation (870 aa):
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLL
S
S
VCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDH
E
EIRENLSLKN
GSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNS
L
CGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDD
RITELIGYHPEELLGRSAYEF
Y
HALDSENMTKSHQN
LCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKN
D
VVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDF
GNQN
F
EESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCST
PNSPEDYYT
S
LDNDLKIEVIEKLFAMDTEAKDQCSTQ
TDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTP
Q
HCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSS
M
GGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKT
RSAKGFGARGPDVLSPAMV
A
LSNKLKLKRQLEYEEQAFQDLSG
GDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPM
R
GLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVS
GMASRLLGPSFESYLLPELT
R
YDCEVNVPVLGSSTLLQGGDLLRALDQAT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser