NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS944.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
944.1 Public Homo sapiens 1 VPS45 22 109 92 CCDS HistoryNCBI Gene:11311Re-query CCDS DB by CCDS ID:944.1Re-query CCDS DB by GeneID:11311See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 944.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000369130.7 ENSP00000358126.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000369130.7Link to Ensembl Protein Viewer:ENSP00000358126.3Re-query CCDS DB by Nucleotide ID:ENST00000369130Re-query CCDS DB by Protein ID:ENSP00000358126
Original member Current member EBI,WTSI ENST00000644510.1 ENSP00000495563.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000644510.1Link to Ensembl Protein Viewer:ENSP00000495563.1Re-query CCDS DB by Nucleotide ID:ENST00000644510Re-query CCDS DB by Protein ID:ENSP00000495563
Original member NCBI NM_007259.4 NP_009190.2 Updated not alive Link to Nucleotide Sequence:NM_007259.4Link to Protein Sequence:NP_009190.2Re-query CCDS DB by Nucleotide ID:NM_007259Re-query CCDS DB by Protein ID:NP_009190
Current member NCBI NM_007259.5 NP_009190.2 Accepted alive Link to Nucleotide Sequence:NM_007259.5Link to Protein Sequence:NP_009190.2Re-query CCDS DB by Nucleotide ID:NM_007259Re-query CCDS DB by Protein ID:NP_009190Link to BLAST:NP_009190.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_009190.2 570 Q9NRW7-1 570 100% 0 0

Chromosomal Locations for CCDS 944.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 150067858 150067950 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150068630 150068764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150072166 150072226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150076233 150076312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150076916 150076984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150077094 150077231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150077669 150077779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150081342 150081476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150081884 150081997 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150082716 150082883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150091937 150092095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150092302 150092409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150093527 150093648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150110496 150110627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 150144709 150144796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1713 nt):
ATGAACGTGGTTTTTGCTGTGAAGCAGTACATTTCCAAAATGATAGAGGACAGCGGGCCTGGTATGAAAG
TA
CTTCTCATGGATAAAGAGACGACTGGCATAGTGAGTATGGTATACACACAATCGGAGATTCTACAGAA
G
GAAGTGTACCTCTTTGAACGCATTGATTCTCAAAATCGAGAGATCATGAAACACCTGAAGGCAATTTGT
TTT
CTTCGACCTACAAAGGAGAATGTGGATTATATTATTCAGGAGCTCCGAAGACCCAAATACACTATAT
AT
TTCATTTATTTCAGTAATGTGATCAGCAAGAGTGACGTGAAGTCATTGGCTGAAGCTGATGAACAGGA
A
GTTGTGGCTGAGGTTCAGGAATTTTATGGTGATTACATTGCTGTGAACCCACATTTGTTTTCCCTCAAT
ATT
TTGGGTTGCTGCCAGGGTCGAAATTGGGATCCAGCCCAGCTATCTAGAACAACTCAAGGGCTTACAG
CT
CTCCTTTTATCTCTGAAGAAGTGTCCCATGATTCGTTATCAGCTCTCATCAGAGGCAGCAAAGAGACT
T
GCAGAGTGCGTTAAGCAAGTGATAACTAAAGAATATGAACTGTTTGAATTCCGTCGGACAGAGGTTCCT
CCA
TTGCTCCTTATTTTAGATCGCTGTGATGATGCCATCACCCCATTGCTAAACCAGTGGACATATCAGG
CC
ATGGTCCACGAACTACTAGGCATAAACAACAATCGGATTGATCTTTCCAGAGTGCCGGGAATCAGTAA
A
GACTTAAGAGAAGTGGTCCTATCTGCTGAAAATGATGAATTCTATGCTAATAATATGTACCTGAACTTT
GCT
GAGATTGGTAGCAATATAAAGAATCTCATGGAAGATTTTCAGAAGAAGAAACCAAAAGAACAGCAAA
AA
CTAGAATCAATAGCAGACATGAAGGCGTTTGTTGAGAATTATCCACAGTTCAAGAAAATGTCTGGGAC
T
GTTTCAAAGCATGTGACAGTGGTTGGAGAACTGTCTCGATTGGTCAGTGAACGGAATCTGCTGGAGGTT
TCA
GAGGTTGAGCAAGAACTGGCCTGTCAAAATGACCATTCTAGTGCTCTCCAGAATATAAAAAGGCTTC
TG
CAGAACCCCAAAGTGACAGAGTTTGATGCTGCCCGCCTGGTGATGCTTTATGCTTTACATTATGAGCG
A
CACAGCAGCAATAGCCTGCCAGGACTAATGATGGACCTCAGGAATAAAGGTGTTTCTGAGAAGTATCGA
AAG
CTCGTGTCTGCAGTTGTTGAATATGGTGGTAAACGAGTCAGAGGAAGTGACCTCTTCAGCCCCAAAG
AT
GCTGTGGCTATCACCAAACAATTCCTCAAAGGACTGAAGGGAGTAGAAAATGTATATACACAGCATCA
A
CCTTTCCTACATGAAACCCTGGATCATCTCATCAAAGGAAGGCTTAAGGAAAACCTATATCCTTATTTA
GGC
CCCAGCACACTCAGAGACAGACCTCAGGATATCATTGTGTTTGTAATTGGAGGAGCCACCTATGAAG
AG
GCTCTAACAGTTTATAACCTGAACCGCACCACTCCTGGAGTGAGGATTGTCCTGGGAGGCACCACAGT
G
CACAACACGAAAAGTTTCCTAGAGGAAGTTCTGGCTTCTGGACTGCACAGCCGAAGCAAGGAGAGCTCT
CAA
GTCACATCAAGGTCAGCGAGCAGAAGATGA


Translation (570 aa):
MNVVFAVKQYISKMIEDSGPGMKVLLMDKETTGIVSMVYTQSEILQKEVYLFERIDSQNREIMKHLKAIC
F
LRPTK
ENVDYIIQELRRPKYTIYFIYFSNVISKSDVKSLAEADEQEVVAEVQEFYGDYIAVNPHLFSLN
I
LGCCQ
GRNWDPAQLSRTTQGLTALLLSLKKCPMIRYQLSSEAAKRLAECVKQVITKEYELFEFRRTEVP
P
LLLILDRCDDAITPLLNQ
WTYQAMVHELLGINNNRIDLSRVPGISKDLREVVLSAENDEFYANNMYLNF
A
EIGSNIKNLMEDFQKKKPKEQQKLESIADMK
AFVENYPQFKKMSGTVSKHVTVVGELSRLVSERNLLEV
S
EVEQELACQNDHSSALQ
NIKRLLQNPKVTEFDAARLVMLYALHYERHSSNSLPGLMMDLRNKGVSEKYR
K
LVSAVVEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDHLIKGRLKENLYPYL
G
PSTLRD
RPQDIIVFVIGGATYEEALTVYNLNRTTPGVRIVLGGTTVHNTKSFLEEVLASGLHSRSKESS
Q
VTSRSASRR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser