NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9385.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9385.1 Public Homo sapiens 13 TNFSF11 22 109 92 CCDS HistoryNCBI Gene:8600Re-query CCDS DB by CCDS ID:9385.1Re-query CCDS DB by GeneID:8600See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9385.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000358545.6 ENSP00000351347.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000358545.6Link to Ensembl Protein Viewer:ENSP00000351347.2Re-query CCDS DB by Nucleotide ID:ENST00000358545Re-query CCDS DB by Protein ID:ENSP00000351347
Original member Current member EBI,WTSI ENST00000405262.6 ENSP00000384042.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000405262.6Link to Ensembl Protein Viewer:ENSP00000384042.2Re-query CCDS DB by Nucleotide ID:ENST00000405262Re-query CCDS DB by Protein ID:ENSP00000384042
Original member Current member EBI,WTSI ENST00000544862.5 ENSP00000444913.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000544862.5Link to Ensembl Protein Viewer:ENSP00000444913.1Re-query CCDS DB by Nucleotide ID:ENST00000544862Re-query CCDS DB by Protein ID:ENSP00000444913
Original member Current member NCBI NM_033012.3 NP_143026.1 Accepted alive Link to Nucleotide Sequence:NM_033012.3Link to Protein Sequence:NP_143026.1Re-query CCDS DB by Nucleotide ID:NM_033012Re-query CCDS DB by Protein ID:NP_143026Link to BLAST:NP_143026.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_143026.1 244 O14788-2 244 100% 0 0

Chromosomal Locations for CCDS 9385.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 42581126 42581293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 42600752 42600797 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 42600883 42600981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 42606497 42606918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (735 nt):
ATGGATCCTAATAGAATATCAGAAGATGGCACTCACTGCATTTATAGAATTTTGAGACTCCATGAAAATG
CA
GATTTTCAAGACACAACTCTGGAGAGTCAAGATACAAAATTAATACCTGATTCATGTAGGAGAATTAA
A
CAGGCCTTTCAAGGAGCTGTGCAAAAGGAATTACAACATATCGTTGGATCACAGCACATCAGAGCAGAG
AAA
GCGATGGTGGATGGCTCATGGTTAGATCTGGCCAAGAGGAGCAAGCTTGAAGCTCAGCCTTTTGCTC
AT
CTCACTATTAATGCCACCGACATCCCATCTGGTTCCCATAAAGTGAGTCTGTCCTCTTGGTACCATGA
T
CGGGGTTGGGCCAAGATCTCCAACATGACTTTTAGCAATGGAAAACTAATAGTTAATCAGGATGGCTTT
TAT
TACCTGTATGCCAACATTTGCTTTCGACATCATGAAACTTCAGGAGACCTAGCTACAGAGTATCTTC
AA
CTAATGGTGTACGTCACTAAAACCAGCATCAAAATCCCAAGTTCTCATACCCTGATGAAAGGAGGAAG
C
ACCAAGTATTGGTCAGGGAATTCTGAATTCCATTTTTATTCCATAAACGTTGGTGGATTTTTTAAGTTA
CGG
TCTGGAGAGGAAATCAGCATCGAGGTCTCCAACCCCTCCTTACTGGATCCGGATCAGGATGCAACAT
AC
TTTGGGGCTTTTAAAGTTCGAGATATAGATTGA


Translation (244 aa):
MDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAE
K
AMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGF
Y
YLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKL
R
SGEEISIEVSNPSLLDPDQDATYFGAFKVRDID




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser