NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS9070.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9070.1 Public Homo sapiens 12 APAF1 22 109 92 CCDS HistoryNCBI Gene:317Re-query CCDS DB by CCDS ID:9070.1Re-query CCDS DB by GeneID:317See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9070.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000357310.5 ENSP00000349862.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000357310.5Link to Ensembl Protein Viewer:ENSP00000349862.1Re-query CCDS DB by Nucleotide ID:ENST00000357310Re-query CCDS DB by Protein ID:ENSP00000349862
Original member Current member EBI,WTSI ENST00000547045.5 ENSP00000449791.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000547045.5Link to Ensembl Protein Viewer:ENSP00000449791.1Re-query CCDS DB by Nucleotide ID:ENST00000547045Re-query CCDS DB by Protein ID:ENSP00000449791
Original member Current member NCBI NM_181868.1 NP_863658.1 Accepted alive Link to Nucleotide Sequence:NM_181868.1Link to Protein Sequence:NP_863658.1Re-query CCDS DB by Nucleotide ID:NM_181868Re-query CCDS DB by Protein ID:NP_863658Link to BLAST:NP_863658.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_863658.1 1205 O14727-4 1205 100% 0 0

Chromosomal Locations for CCDS 9070.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 98648360 98648497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98648626 98648815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98649487 98649684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98659160 98659343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98662456 98662568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98662675 98662806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98665553 98665791 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98666190 98666357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98667513 98667644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98670973 98671086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98671535 98671719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98677425 98677551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98680277 98680402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98683143 98683274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98686748 98686873 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98699408 98699569 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98706485 98706610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98708585 98708704 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98712319 98712435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98715427 98715552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98723193 98723312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98723639 98723764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98725415 98725540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98727173 98727316 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 98732420 98732566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3618 nt):
ATGGATGCAAAAGCTCGAAATTGTTTGCTTCAACATAGAGAAGCTCTGGAAAAGGACATCAAGACATCCT
AC
ATCATGGATCACATGATTAGTGATGGATTTTTAACAATATCAGAAGAGGAAAAAGTAAGAAATGAGCC
C
ACTCAACAGCAAAGAGCAGCTATGCTGATTAAAATGATACTTAAAAAAGATAATGATTCCTACGTATCA
TTC
TACAATGCTCTACTACATGAAGGATATAAAGATCTTGCTGCCCTTCTCCATGATGGCATTCCTGTTG
TC
TCTTCTTCCAGTGGTAAAGATTCAGTTAGTGGAATAACTTCGTATGTAAGGACAGTCCTGTGTGAAGG
T
GGAGTACCACAGAGGCCAGTTGTTTTTGTCACAAGGAAGAAGCTGGTGAATGCAATTCAGCAGAAGCTC
TCC
AAATTGAAAGGTGAACCAGGATGGGTCACCATACATGGAATGGCAGGCTGTGGGAAGTCTGTATTAG
CT
GCAGAAGCTGTTAGAGATCATTCCCTTTTAGAAGGTTGTTTCCCAGGGGGAGTGCATTGGGTTTCAGT
T
GGGAAACAAGACAAATCTGGGCTTCTGATGAAACTGCAGAATCTTTGCACACGGTTGGATCAGGATGAG
AGT
TTTTCCCAGAGGCTTCCACTTAATATTGAAGAGGCTAAAGACCGTCTCCGCATTCTGATGCTTCGCA
AA
CACCCAAGGTCTCTCTTGATCTTGGATGATGTTTGGGACTCTTGGGTGTTGAAAGCTTTTGACAGTCA
G
TGTCAGATTCTTCTTACAACCAGAGACAAGAGTGTTACAGATTCAGTAATGGGTCCTAAATATGTAGTC
CCT
GTGGAGAGTTCCTTAGGAAAGGAAAAAGGACTTGAAATTTTATCCCTTTTTGTTAATATGAAGAAGG
CA
GATTTGCCAGAACAAGCTCATAGTATTATAAAAGAATGTAAAGGCTCTCCCCTTGTAGTATCTTTAAT
T
GGTGCACTTTTACGTGATTTTCCCAATCGCTGGGAGTACTACCTCAAACAGCTTCAGAATAAGCAGTTT
AAG
AGAATAAGGAAATCTTCGTCTTATGATTATGAGGCTCTAGATGAAGCCATGTCTATAAGTGTTGAAA
TG
CTCAGAGAAGACATCAAAGATTATTACACAGATCTTTCCATCCTTCAGAAGGACGTTAAGGTGCCTAC
A
AAGGTGTTATGTATTCTCTGGGACATGGAAACTGAAGAAGTTGAAGACATACTGCAGGAGTTTGTAAAT
AAG
TCTCTTTTATTCTGTGATCGGAATGGAAAGTCGTTTCGTTATTATTTACATGATCTTCAAGTAGATT
TT
CTTACAGAGAAGAATTGCAGCCAGCTTCAGGATCTACATAAGAAGATAATCACTCAGTTTCAGAGATA
T
CACCAGCCGCATACTCTTTCACCAGATCAGGAAGACTGTATGTATTGGTACAACTTTCTGGCCTATCAC
ATG
GCCAGTGCCAAGATGCACAAGGAACTTTGTGCTTTAATGTTTTCCCTGGATTGGATTAAAGCAAAAA
CA
GAACTTGTAGGCCCTGCTCATCTGATTCATGAATTTGTGGAATACAGACATATACTAGATGAAAAGGA
T
TGTGCAGTCAGTGAGAATTTTCAGGAGTTTTTATCTTTAAATGGACACCTTCTTGGACGACAGCCATTT
CCT
AATATTGTACAACTGGGTCTCTGTGAGCCGGAAACTTCAGAAGTTTATCAGCAAGCTAAGCTGCAGG
CC
AAGCAGGAGGTCGATAATGGAATGCTTTACCTGGAATGGATAAACAAAAAAAACATCACGAATCTTTC
C
CGCTTAGTTGTCCGCCCCCACACAGATGCTGTTTACCATGCCTGCTTTTCTGAGGATGGTCAGAGAATA
GCT
TCTTGTGGAGCTGATAAAACCTTACAGGTGTTCAAAGCTGAAACAGGAGAGAAACTTCTAGAAATCA
AG
GCTCATGAGGATGAAGTGCTTTGTTGTGCATTCTCTACAGATGACAGATTTATAGCAACCTGCTCAGT
G
GATAAAAAAGTGAAGATTTGGAATTCTATGACTGGGGAACTAGTACACACCTATGATGAGCACTCAGAG
CAA
GTCAATTGCTGCCATTTCACCAACAGTAGTCATCATCTTCTCTTAGCCACTGGGTCAAGTGACTGCT
TC
CTCAAACTTTGGGATTTGAATCAAAAAGAATGTCGAAATACCATGTTTGGTCATACAAATTCAGTCAA
T
CACTGCAGATTTTCACCAGATGATAAGCTTTTGGCTAGTTGTTCAGCTGATGGAACCTTAAAGCTTTGG
GAT
GCGACATCAGCAAATGAGAGGAAAAGCATTAATGTGAAACAGTTCTTCCTAAATTTGGAGGACCCTC
AA
GAGGATATGGAAGTGATAGTGAAGTGTTGTTCGTGGTCTGCTGATGGTGCAAGGATAATGGTGGCAGC
A
AAAAATAAAATCTTTTTGTGGAATACAGACTCACGTTCAAAGGTGGCTGATTGCAGAGGACATTTAAGT
TGG
GTTCATGGTGTGATGTTTTCTCCTGATGGATCATCATTTTTGACATCTTCTGATGACCAGACAATCA
GG
CTCTGGGAGACAAAGAAAGTATGTAAGAACTCTGCTGTAATGTTAAAGCAAGAAGTAGATGTTGTGTT
T
CAAGAAAATGAAGTGATGGTCCTTGCAGTTGACCATATAAGACGTCTGCAACTCATTAATGGAAGAACA
GGT
CAGATTGATTATCTGACTGAAGCTCAAGTTAGCTGCTGTTGCTTAAGTCCACATCTTCAGTACATTG
CA
TTTGGAGATGAAAATGGAGCCATTGAGATTTTAGAACTTGTAAACAATAGAATCTTCCAGTCCAGGTT
T
CAGCACAAGAAAACTGTATGGCACATCCAGTTCACAGCCGATGAGAAGACTCTTATTTCAAGTTCTGAT
GAT
GCTGAAATTCAGGTATGGAATTGGCAATTGGACAAATGTATCTTTCTACGAGGCCATCAGGAAACAG
TG
AAAGACTTTAGACTCTTGAAAAATTCAAGACTGCTTTCTTGGTCATTTGATGGAACAGTGAAGGTATG
G
AATATTATTACTGGAAATAAAGAAAAAGACTTTGTCTGTCACCAGGGTACAGTACTTTCTTGTGACATT
TCT
CACGATGCTACCAAGTTTTCATCTACCTCTGCTGACAAGACTGCAAAGATCTGGAGTTTTGATCTCC
TT
TTGCCACTTCATGAATTGAGGGGCCACAACGGCTGTGTGCGCTGCTCTGCCTTCTCTGTGGACAGTAC
C
CTGCTGGCAACGGGAGATGACAATGGAGAAATCAGGATATGGAATGTCTCAAACGGTGAGCTTCTTCAT
TTG
TGTGCTCCGCTTTCAGAAGAAGGAGCTGCTACCCATGGAGGCTGGGTGACTGACCTTTGCTTTTCTC
CA
GATGGCAAAATGCTTATCTCTGCTGGAGGATATATTAAGTGGTGGAACGTTGTCACTGGGGAATCCTC
A
CAGACCTTCTACACAAATGGAACCAATCTTAAGAAAATACACGTGTCCCCTGACTTCAAAACATATGTG
ACT
GTGGATAATCTTGGTATTTTATATATTTTACAGACTTTAGAATAA


Translation (1205 aa):
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDSYVS
F
YNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSY
VRTVLCEGGVPQRPVVFVTRKKLVNAIQQKL
S
KLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLE
GCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDE
S
FSQRLPLNIEEAKDRLRILMLRKHP
RSLLILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVV
P
VESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKECK
GSPLVVSLIGALLRDFPNRWEYYLKQLQNKQF
K
RIRKSSSYDYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTK
VLCILWDMETEEVEDILQEFVN
K
SLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQ
DLHKKIITQFQRYHQPHTLSPDQEDCMYWYNFLAYH
M
ASAKMHK
ELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSENFQEFLSLNGHLLGRQPF
P
NIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEW
INKKNITNLSRLVVRPHTDAVYHACFSEDGQRI
A
SCGADKTLQ
VFKAETGEKLLEIKAHEDEVLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSE
Q
VNCCHFTNSSHHLLLATGSSDCFLK
LWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLW
D
ATSANERKSINVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIF
LWNTDSRSKVADCRGHLS
W
VHGVMFSPDGSSFLTSSDDQTIR
LWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRT
G
QIDYLTEAQVSCCCLSPHLQYIAFGDENGAIE
ILELVNNRIFQSRFQHKKTVWHIQFTADEKTLISSSD
D
AEIQ
VWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKDFVCHQGTVLSCDI
S
HDATKFSSTSADKTAK
IWSFDLLLPLHELRGHNGCVRCSAFSVDSTLLATGDDNGEIRIWNVSNGELLH
L
CAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYV
T
VDNLGILYILQTLE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser