NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS87214.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
87214.1 Public Homo sapiens 4 RBPJ 22 109 92 CCDS HistoryNCBI Gene:3516Re-query CCDS DB by CCDS ID:87214.1Re-query CCDS DB by GeneID:3516See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 22, NCBI annotation release 109, Ensembl annotation release 92

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 87214.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000507561.5 ENSP00000423907.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000507561.5Link to Ensembl Protein Viewer:ENSP00000423907.1Re-query CCDS DB by Nucleotide ID:ENST00000507561Re-query CCDS DB by Protein ID:ENSP00000423907
Current member NCBI NM_001363577.1 NP_001350506.1 Accepted alive Link to Nucleotide Sequence:NM_001363577.1Link to Protein Sequence:NP_001350506.1Re-query CCDS DB by Nucleotide ID:NM_001363577Re-query CCDS DB by Protein ID:NP_001350506Link to BLAST:NP_001350506.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001350506.1 465 Q06330-5 465 100% 0 0

Chromosomal Locations for CCDS 87214.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 26406182 26406270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 26415475 26415640 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 26420551 26420725 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 26424342 26424479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 26424631 26424743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 26428720 26428860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 26429898 26430053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 26430419 26430522 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 26430692 26431007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1398 nt):
ATGCGAAATTATTTAAAAGAGCGAGGGGATCAAACAGTACTTATTCTTCATGCAAAAGTTGCACAGAAGT
CA
TATGGAAATGAAAAAAGGTTTTTTTGCCCACCTCCTTGTGTATATCTTATGGGCAGTGGATGGAAGAA
A
AAAAAAGAACAAATGGAACGCGATGGTTGTTCTGAACAAGAGTCTCAACCGTGTGCATTTATTGGGATA
GGA
AATAGTGACCAAGAAATGCAGCAGCTAAACTTGGAAGGAAAGAACTATTGCACAGCCAAAACATTGT
AT
ATATCTGACTCAGACAAGCGAAAGCACTTCATGTTGTCTGTAAAGATGTTCTATGGCAACAGTGATGA
C
ATTGGTGTGTTCCTCAGCAAGCGGATAAAAGTCATCTCCAAACCTTCCAAAAAGAAGCAGTCATTGAAA
AAT
GCTGACTTATGCATTGCCTCAGGAACAAAGGTGGCTCTGTTTAATCGACTACGATCCCAGACAGTTA
GT
ACCAGATACTTGCATGTAGAAGGAGGTAATTTTCATGCCAGTTCACAGCAGTGGGGAGCCTTTTTTAT
T
CATCTCTTGGATGATGATGAATCAGAAGGAGAAGAATTCACAGTCCGAGATGGCTACATCCATTATGGA
CAA
ACAGTCAAACTTGTGTGCTCAGTTACTGGCATGGCACTCCCAAGATTGATAATTAGGAAAGTTGATA
AG
CAGACCGCATTATTGGATGCAGATGATCCTGTGTCACAACTCCATAAATGTGCATTTTACCTTAAGGA
T
ACAGAAAGAATGTATTTGTGCCTTTCTCAAGAAAGAATAATTCAATTTCAGGCCACTCCATGTCCAAAA
GAA
CCAAATAAAGAGATGATAAATGATGGCGCTTCCTGGACAATCATTAGCACAGATAAGGCAGAGTATA
CA
TTTTATGAGGGAATGGGCCCTGTCCTTGCCCCAGTCACTCCTGTGCCTGTGGTAGAGAGCCTTCAGTT
G
AATGGCGGTGGGGACGTAGCAATGCTTGAACTTACAGGACAGAATTTCACTCCAAATTTACGAGTGTGG
TTT
GGGGATGTAGAAGCTGAAACTATGTACAGGTGTGGAGAGAGTATGCTCTGTGTCGTCCCAGACATTT
CT
GCATTCCGAGAAGGTTGGAGATGGGTCCGGCAACCAGTCCAGGTTCCAGTAACTTTGGTCCGAAATGA
T
GGAATCATTTATTCCACCAGCCTTACCTTTACCTACACACCAGAACCAGGGCCGCGGCCACATTGCAGT
GCA
GCAGGAGCAATCCTTCGAGCCAATTCAAGCCAGGTGCCCCCTAACGAATCAAACACAAACAGCGAGG
GA
AGTTACACAAACGCCAGCACAAATTCAACCAGTGTCACATCATCTACAGCCACAGTGGTATCCTAA


Translation (465 aa):
MRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGI
G
NSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLK
N
AD
LCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYG
Q
TVKLVCSVTGMALPRL
IIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPK
E
PNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQ
LNGGGDVAMLELTGQNFTPNLRVW
F
GDVEAETMY
RCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCS
A
AGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser