NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS87208.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
87208.1 Public Homo sapiens 4 FAM90A26 22 109 92 CCDS HistoryNCBI Gene:100287045Re-query CCDS DB by CCDS ID:87208.1Re-query CCDS DB by GeneID:100287045See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 22, NCBI annotation release 109, Ensembl annotation release 92

Review status: Provisional (this record has not been manually reviewed by the collaboration)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 87208.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000512047.2 ENSP00000421131.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000512047.2Link to Ensembl Protein Viewer:ENSP00000421131.1Re-query CCDS DB by Nucleotide ID:ENST00000512047Re-query CCDS DB by Protein ID:ENSP00000421131
Original member Current member NCBI NM_001358418.1 NP_001345347.1 Accepted alive Link to Nucleotide Sequence:NM_001358418.1Link to Protein Sequence:NP_001345347.1Re-query CCDS DB by Nucleotide ID:NM_001358418Re-query CCDS DB by Protein ID:NP_001345347Link to BLAST:NP_001345347.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001345347.1 464 D6RGX4 464 100% 0 0

Chromosomal Locations for CCDS 87208.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 9173173 9173295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 9173790 9173989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 9174448 9174556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 9175205 9176167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1395 nt):
ATGATGGCATGTCGTGACCCCAAACCTGGGGCAAAGAGACTGGTGAGAGCCCAGACCCTCCAGAAGCAGC
GG
AGAGCCCCAGTTGGGCCAAGGGCTCCCCCGCCCGATGAAGAAGATCCCAGGCTCAAGTGCAAAAACTG
T
GGGGCCTTTGGTCACATGGCCAGAAGTACCAGGTGCCCCATGAAGTGCTGGAAGGCAGCCCTGGTTCCA
CCG
ACCTTGGGGAAAAAGGAAGGGAAGGAAAACCTGAAACCATGGAAGCCCCAGGTTGAAGCAAACCCGG
GG
CCCTTGAACAAGGATAAGGGAGAGAAGGAAGAGAGACCAAGGCAACAAGACCCGCAGAGGAAGGCTCT
C
CTCCACATATTTTCCGGGAAACCTCCAGAGAAGCCGCTGCCAAATCGAAAAGGATCCACGGAATCTTCT
GTT
TATCTGAGGGTTGCAAGCGGGCCAATGCCGGTCCACACAACCAGTAAGAGGCCGCGTGTGGACCCTG
TC
CTCGCTGATCGCTCAGCTACCGAAATGTCTGACAGGGGCTCCGCCTTGGCTTCACTGTCTCCCCTCAG
A
AAAGCCAGTCTGAGCTCCTCCTCAAGTCTTGGACCAAAGGAAAGACAGACAGGGGCTGCGGCCGACATC
CCT
CAGCCTGCAGTCAGACACCAGGGCCCCGAGCCTCTCCTCGTGGTGAAGCCGACACACAGCAGCCCTG
AG
GGTGGCTGCCGAGAAGTTCCCCAGGCTGCCTCCAAAACCCACGGCCTGCTCCAGGCCATCAGCCCCCA
G
GCACAAGACAAACGTCCTGCGGTGACCTCACAGCCCTGCCCACCAGCCGCCACACATAGCTTGGGTCTA
GGC
TCCAATCTCAGCTTCGGGCCAGGAGCCAAGAGACCTGCCCAGGCTCCGATTCAGGCTTGCCTGAACT
TC
CCCAAGAAACCGAGGCTGGGTCCCTTCCAGATCCCCGAAAGCGCCATCCAGGGAGGTGAGCTGGGGGC
C
CCGGAGTATCTCCAACCTCCGCCGGCAACAACCGAACTTGGACCAAGTACGTCGCCCCAGATGGGCAGG
AGG
ACACCCGCCCAGGTGTCCAGCGTCGACCGGCAGCCTCCGCACAGCAGACCTTGCCTGCCTACTGCCC
AG
GCCTGCACCATGTCCCATCACCCAGCGACCAGCCATGATGGGGCCCAGCCTCTCAGAGTGCTCTTCCG
G
AGACTGGAAAACGGACGCTGGAGCTCCAGCCTCCTGGCGGCCCCCTCATTTCACTCTCCTGAGAAGCCG
GGA
GCCTTCCTCGCTCAGAGCCCTCATGTCTCAGAGAAGTCTGAGGTTCCCCGTGTTCGTGTCCCACCGA
AC
GTCCTCTATGAGGACCTTCAGGTTTCCTCCTCCTCAGAGGACAGCGACTCTGACCTGGAGTGA


Translation (464 aa):
MMACRDPKPGAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHMARSTRCPMKCWKAALVP
P
TLGKKEGKENLKPWKPQVEANPGPLNKDKGEKEERP
RQQDPQRKALLHIFSGKPPEKPLPNRKGSTESS
V
YLR
VASGPMPVHTTSKRPRVDPVLADRSATEMSDRGSALASLSPLRKASLSSSSSLGPKERQTGAAADI
P
QPAVRHQGPEPLLVVKPTHSSPEGGCREVPQAASKTHGLLQAISPQAQDKRPAVTSQPCPPAATHSLGL
G
SNLSFGPGAKRPAQAPIQACLNFPKKPRLGPFQIPESAIQGGELGAPEYLQPPPATTELGPSTSPQMGR
R
TPAQVSSVDRQPPHSRPCLPTAQACTMSHHPATSHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
G
AFLAQSPHVSEKSEVPRVRVPPNVLYEDLQVSSSSEDSDSDLE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser