NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS8178.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8178.1 Public Homo sapiens 11 CHKA 22 109 92 CCDS HistoryNCBI Gene:1119Re-query CCDS DB by CCDS ID:8178.1Re-query CCDS DB by GeneID:1119See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8178.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000265689.8 ENSP00000265689.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000265689.8Link to Ensembl Protein Viewer:ENSP00000265689.4Re-query CCDS DB by Nucleotide ID:ENST00000265689Re-query CCDS DB by Protein ID:ENSP00000265689
Original member Current member NCBI NM_001277.2 NP_001268.2 Accepted alive Link to Nucleotide Sequence:NM_001277.2Link to Protein Sequence:NP_001268.2Re-query CCDS DB by Nucleotide ID:NM_001277Re-query CCDS DB by Protein ID:NP_001268Link to BLAST:NP_001268.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001268.2 457 P35790-1 457 100% 0 0

Chromosomal Locations for CCDS 8178.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 68053988 68054047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68061953 68062034 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68064525 68064631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68065786 68065894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68066429 68066516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68068879 68068937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68070189 68070293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68070724 68070857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68074717 68074830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68081404 68081457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68097019 68097130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68120828 68121177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1374 nt):
ATGAAAACCAAATTCTGCACCGGGGGCGAGGCGGAGCCCTCGCCGCTCGGGCTGCTGCTGAGCTGCGGTA
GC
GGCAGCGCGGCCCCGGCGCCCGGCGTGGGGCAGCAGCGCGACGCCGCCAGCGACCTCGAGTCCAAGCA
G
CTGGGCGGCCAACAGCCGCCGCTCGCGCTGCCCCCTCCGCCGCCGCTGCCGCTGCCGCTGCCGCTGCCC
CAG
CCCCCGCCGCCGCAGCCGCCCGCAGACGAGCAGCCGGAGCCCCGGACGCGGCGCAGGGCCTATCTGT
GG
TGCAAGGAGTTCCTGCCCGGCGCCTGGCGGGGCCTCCGCGAGGACGAGTTCCACATCAGTGTCATCAG
A
GGCGGCCTTAGCAACATGCTGTTCCAGTGCTCCCTACCTGACACCACAGCCACCCTTGGTGATGAGCCT
CGG
AAAGTGCTCCTGCGGCTGTATGGAGCGATTTTGCAGATGAGGTCCTGTAATAAAGAGGGATCCGAAC
AA
GCTCAGAAAGAAAATGAATTTCAAGGGGCTGAGGCCATGGTTCTGGAGAGCGTTATGTTTGCCATTCT
C
GCAGAGAGGTCACTTGGGCCAAAACTCTATGGCATCTTTCCCCAAGGCCGACTGGAGCAGTTCATCCCG
AGC
CGGCGATTAGATACTGAAGAATTAAGTTTGCCAGATATTTCTGCAGAAATCGCCGAGAAAATGGCTA
CA
TTTCATGGTATGAAAATGCCATTCAATAAGGAACCAAAATGGCTTTTTGGCACAATGGAAAAGTATCT
A
AAGGAAGTGCTGAGAATTAAATTTACTGAGGAATCCAGAATTAAAAAGCTCCACAAATTGCTCAGTTAC
AAT
CTGCCCTTGGAACTGGAAAACCTGAGATCATTGCTTGAATCTACTCCATCTCCAGTTGTATTTTGTC
AT
AATGACTGTCAAGAAGGTAATATCTTGTTGCTGGAAGGCCGAGAGAATTCTGAAAAACAGAAACTGAT
G
CTCATTGATTTCGAATACAGCAGTTACAATTACAGGGGATTCGACATTGGAAATCACTTCTGTGAGTGG
ATG
TATGATTATAGCTATGAAAAATACCCTTTTTTCAGAGCAAACATCCGGAAGTATCCCACCAAGAAAC
AA
CAGCTCCATTTTATTTCCAGTTACTTGCCTGCATTCCAAAATGACTTTGAAAACCTCAGTACTGAAGA
A
AAATCCATTATAAAAGAAGAAATGTTGCTTGAAGTTAATAGGTTTGCCCTTGCATCTCATTTCCTCTGG
GGA
CTGTGGTCCATTGTACAAGCCAAGATTTCATCTATTGAATTTGGGTACATGGACTACGCCCAAGCAA
GG
TTTGATGCCTATTTCCACCAGAAGAGGAAGCTTGGGGTGTGA


Translation (457 aa):
MKTKFCTGGEAEPSPLGLLLSCGSGSAAPAPGVGQQRDAASDLESKQLGGQQPPLALPPPPPLPLPLPLP
Q
PPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVI
RGGLSNMLFQCSLPDTTATLGDEP
R
KVLLRLYGAILQM
RSCNKEGSEQAQKENEFQGAEAMVLESVMFAILAERSLGPKLYGIFPQGRLEQFIP
S
RRLDTEELSLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTME
KYLKEVLRIKFTEESRIKKLHKLLSY
N
LPLELENL
RSLLESTPSPVVFCHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW
M
YDYSYEKYPFFRANIRKYPTKKQQ
LHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLW
G
LWSIVQAKISSIEFGYM
DYAQARFDAYFHQKRKLGV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser