NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS77858.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
77858.1 Public Homo sapiens 3 PHC3 22 109 92 CCDS HistoryNCBI Gene:80012Re-query CCDS DB by CCDS ID:77858.1Re-query CCDS DB by GeneID:80012See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 18, NCBI annotation release 107, Ensembl annotation release 79

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 77858.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000494943.5 ENSP00000420271.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000494943.5Link to Ensembl Protein Viewer:ENSP00000420271.1Re-query CCDS DB by Nucleotide ID:ENST00000494943Re-query CCDS DB by Protein ID:ENSP00000420271
Original member NCBI NM_001308116.1 NP_001295045.1 Updated not alive Link to Nucleotide Sequence:NM_001308116.1Link to Protein Sequence:NP_001295045.1Re-query CCDS DB by Nucleotide ID:NM_001308116Re-query CCDS DB by Protein ID:NP_001295045
Current member NCBI NM_001308116.2 NP_001295045.1 Accepted alive Link to Nucleotide Sequence:NM_001308116.2Link to Protein Sequence:NP_001295045.1Re-query CCDS DB by Nucleotide ID:NM_001308116Re-query CCDS DB by Protein ID:NP_001295045Link to BLAST:NP_001295045.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001295045.1 983 Q8NDX5-1 983 100% 0 0

Chromosomal Locations for CCDS 77858.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 170097230 170097384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170102479 170102710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170102802 170102934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170106832 170106946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170113360 170113519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170117226 170117476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170122591 170122744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170128684 170129552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170136419 170136665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170145423 170145521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170149086 170149244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170171373 170171450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170172557 170172712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 170178773 170178916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2952 nt):
ATGGATACTGAACCAAACCCGGGAACATCTTCTGTGTCAACAACAACCAGCAGTACCACCACCACCACCA
TC
ACCACTTCCTCCTCTCGAATGCAGCAGCCACAGATCTCTGTCTACAGTGGTTCAGACCGACATGCTGT
A
CAGGTAATTCAACAGGCATTGCATCGGCCCCCCAGCTCAGCTGCTCAGTACCTTCAGCAAATGTATGCA
GCC
CAACAACAGCACTTGATGCTGCATACTGCAGCTCTTCAGCAGCAGCATTTAAGCAGCTCCCAGCTTC
AG
AGCCTTGCTGCTGTTCAGGCAAGTTTGTCCAGTGGAAGACCATCTACATCTCCCACAGGAAGTGTCAC
A
CAGCAGTCAAGTATGTCCCAAACGTCTATCAACCTCTCCACTTCTCCTACACCTGCACAGTTAATAAGC
CGT
TCCCAGGCTTCCAGTTCTACCAGCGGCAGTATTACCCAACAGACTATGTTACTAGGGAGTACTTCCC
CT
ACCCTAACGGCAAGCCAAGCTCAAATGTATCTCCGAGCTCAAATGCTGATTTTCACACCCGCTACCAC
T
GTGGCTGCTGTACAGTCTGACATTCCTGTTGTCTCGTCGTCATCGTCATCTTCCTGTCAGTCTGCAGCT
ACT
CAGGTTCAGAATTTAACATTACGCAGCCAGAAGTTGGGTGTATTATCTAGCTCACAGAATGGTCCAC
CA
AAAAGCACTAGTCAAACTCAGTCATTGACAATTTGTCATAACAAAACAACAGTGACCAGTTCTAAAAT
C
AGCCAACGAGATCCTTCTCCAGAAAGTAATAAGAAAGGAGAGAGCCCAAGCCTGGAATCACGAAGCACA
GCT
GTCACCCGGACATCAAGTATTCACCAGTTAATAGCACCAGCTTCATATTCTCCAATTCAGCCTCATT
CT
CTAATAAAACATCAGCAGATTCCTCTTCATTCACCACCTTCCAAAGTTTCCCATCATCAGCTGATATT
A
CAACAGCAGCAACAGCAAATTCAGCCAATCACACTTCAGAATTCAACTCAAGACCCACCCCCATCCCAG
CAC
TGTATACCACTCCAGAACCATGGCCTTCCTCCAGCTCCCAGTAATGCCCAGTCACAGCATTGTTCAC
CG
ATTCAGAGTCATCCCTCTCCTTTAACAGTGTCTCCTAATCAGTCACAGTCAGCACAGCAGTCTGTAGT
G
GTGTCTCCTCCACCACCTCATTCACCAAGTCAGTCTCCTACTATAATTATTCATCCACAAGCACTTATT
CAG
CCACACCCTCTTGTGTCATCAGCTCTCCAGCCAGGGCCAAATTTGCAGCAGTCCACTGCTAATCAGG
TG
CAAGCTACAGCACAGTTGAATCTTCCATCCCATCTTCCACTTCCAGCTTCCCCTGTTGTACACATTGG
C
CCAGTTCAGCAGTCTGCCTTGGTATCCCCAGGCCAGCAGATTGTCTCTCCATCACACCAGCAATATTCA
TCC
CTGCAGTCCTCTCCAATCCCAATTGCAAGTCCTCCACAGATGTCGACATCTCCTCCAGCTCAGATTC
CA
CCACTGCCCTTGCAGTCTATGCAGTCTTTACAAGTGCAGCCTGAAATTCTGTCCCAGGGCCAGGTTTT
G
GTGCAGAATGCTTTGGTGTCAGAAGAGGAACTTCCAGCTGCAGAAGCTTTGGTCCAGTTGCCATTTCAG
ACT
CTTCCTCCTCCACAGACTGTTGCGGTAAACCTACAAGTGCAACCACCAGCACCTGTTGATCCACCAG
TG
GTTTATCAGGTAGAAGATGTGTGTGAAGAAGAAATGCCAGAAGAGTCAGATGAATGTGTCCGGATGGA
T
AGAACCCCACCACCACCCACTTTGTCTCCAGCAGCTATAACAGTGGGGAGAGGAGAAGATTTGACTTCT
GAA
CATCCTTTGTTAGAGCAAGTGGAATTACCTGCTGTGGCATCAGTCAGTGCTTCAGTAATTAAATCTC
CA
TCAGATCCCTCACATGTTTCTGTTCCACCACCTCCATTGTTACTTCCAGCTGCCACCACAAGGAGTAA
C
AGTACATCTATGCACAGTAGCATTCCCAGTATAGAGAACAAACCTCCACAGGCTATTGTTAAACCACAG
ATC
CTAACCCATGTTATTGAAGGCTTTGTGATTCAGGAGGGATTGGAGCCATTTCCTGTGAGTCGTTCCT
CT
TTGCTAATAGAACAGCCTGTGAAAAAACGGCCTCTTTTGGATAATCAGGTGATAAATTCAGTGTGTGT
T
CAGCCAGAGCTACAGAATAATACAAAACATGCGGATAATTCATCTGACACAGAGATGGAAGACATGATT
GCT
GAAGAGACATTAGAAGAAATGGACAGTGAGTTGCTCAAGTGTGAATTCTGTGGGAAAATGGGATATG
CT
AATGAATTTTTGCGGTCAAAACGATTCTGCACTATGTCATGTGCCAAAAGGTACAATGTTAGCTGTTC
T
AAAAAATTTGCACTTAGTCGTTGGAATCGTAAGCCTGATAATCAAAGTCTTGGGCATCGTGGCCGTCGT
CCA
AGTGGCCCTGATGGGGCAGCGAGAGAACATATCCTTAGGCAGCTTCCAATTACTTATCCATCTGCAG
AA
GAAGACTTGGCTTCTCATGAAGATTCTGTGCCATCTGCTATGACAACTCGTCTGCGCAGGCAGAGCGA
G
CGGGAAAGAGAACGTGAGCTTCGGGATGTGAGAATTCGGAAAATGCCTGAGAACAGTGACTTGCTACCA
GTT
GCACAAACAGAGCCATCTATATGGACAGTTGATGATGTCTGGGCCTTCATCCATTCTTTGCCTGGCT
GC
CAGGATATCGCAGATGAATTCAGAGCACAGGAGATTGATGGACAGGCCCTTCTCTTGCTGAAAGAAGA
C
CATCTCATGAGTGCAATGAATATCAAGCTAGGCCCAGCCCTGAAGATCTGTGCACGCATCAACTCTCTG
AAG
GAATCTTAA


Translation (983 aa):
MDTEPNPGTSSVSTTTSSTTTTTITTSSSRMQQPQISVYSGSDRHAVQVIQQALHRPPSSAAQYLQQMYA
A
QQQHLMLHTAALQQQHLSSSQLQSLAAVQ
ASLSSGRPSTSPTGSVTQQSSMSQTSINLSTSPTPAQLIS
R
SQASSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQM
LIFTPATTVAAVQSDIPVVSSSSSSSCQSAA
T
Q
VQNLTLRSQKLGVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRST
A
VTRTSSIHQLIAP
ASYSPIQPHSLIKHQQIPLHSPPSKVSHHQLILQQQQQQIQPITLQNSTQDPPPSQ
H
CIPLQNHGLPPAPSNAQSQHCSPIQSHPSPLTVSPNQSQSAQQSVVVSPPPPHSPSQSPTIIIHPQALI
Q
PHPLVSSALQPGPNLQQSTANQVQATAQLNLPSHLPLPASPVVHIGPVQQSALVSPGQQIVSPSHQQYS
S
LQSSPIPIASPPQMSTSPPAQIPPLPLQSMQSLQVQPEILSQGQVLVQNALVSEEELPAAEALVQLPFQ
T
LPPPQTVAVNLQVQPPAPVDPPV
VYQVEDVCEEEMPEESDECVRMDRTPPPPTLSPAAITVGRGEDLTS
E
HPLL
EQVELPAVASVSASVIKSPSDPSHVSVPPPPLLLPAATTRSNSTSMHSSIPSIENKPPQAIVKPQ
I
LTHVIEGFVIQEGLEPFP
VSRSSLLIEQPVKKRPLLDNQVINSVCVQPELQNNTKHADNSSDTEMEDMI
A
E
ETLEEMDSELLKCEFCGKMGYANEFLRSKRFCTMSCAKRYNVSCSKKFALSRWNRKPDNQSLGHRGRR
P
SGPDGAAREHILRQ
LPITYPSAEEDLASHEDSVPSAMTTRLRRQSERERERELRDVRIRKMPENSDLLP
V
AQTEPSIWTVDDVWAFIHSLP
GCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKICARINSL
K
ES




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser