NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS75802.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
75802.1 Public Homo sapiens 8 OPLAH 22 109 92 CCDS HistoryNCBI Gene:26873Re-query CCDS DB by CCDS ID:75802.1Re-query CCDS DB by GeneID:26873See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 75802.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000618853.4 ENSP00000480476.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000618853.4Link to Ensembl Protein Viewer:ENSP00000480476.1Re-query CCDS DB by Nucleotide ID:ENST00000618853Re-query CCDS DB by Protein ID:ENSP00000480476
Original member NCBI NM_017570.4 NP_060040.1 Updated not alive Link to Nucleotide Sequence:NM_017570.4Link to Protein Sequence:NP_060040.1Re-query CCDS DB by Nucleotide ID:NM_017570Re-query CCDS DB by Protein ID:NP_060040
Current member NCBI NM_017570.5 NP_060040.1 Accepted alive Link to Nucleotide Sequence:NM_017570.5Link to Protein Sequence:NP_060040.1Re-query CCDS DB by Nucleotide ID:NM_017570Re-query CCDS DB by Protein ID:NP_060040Link to BLAST:NP_060040.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060040.1 1288 O14841 1288 100% 0 0

Chromosomal Locations for CCDS 75802.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 144051326 144051472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144051729 144051826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144051916 144052076 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144052169 144052326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144052449 144052598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144052766 144052900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144052983 144053129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144053209 144053393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144054561 144054735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144054812 144054913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144055029 144055189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144055788 144055939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144056147 144056259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144056385 144056523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144056618 144056755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144056948 144057118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144057208 144057320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144057448 144057713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144057856 144057923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144058010 144058148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144058239 144058404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144058496 144058691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144058773 144058896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144058980 144059079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144059599 144059790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144059862 144060032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3867 nt):
ATGGGCAGCCCCGAGGGCCGCTTCCACTTTGCCATCGACCGTGGGGGTACCTTCACAGACGTCTTTGCCC
AG
TGCCCAGGGGGGCACGTGCGGGTCTTAAAACTGCTCTCAGAGGACCCTGCCAACTATGCGGACGCGCC
A
ACCGAAGGCATCCGCCGCATCCTGGAGCAGGAGGCCGGCATGCTCCTGCCCCGGGACCAGCCGCTGGAC
TCC
AGTCATATCGCCAGCATCCGCATGGGCACCACAGTGGCCACCAACGCACTGCTGGAGCGGAAGGGGG
AG
CGGGTGGCGCTGCTGGTGACACGTGGCTTCCGAGACCTGCTGCACATTGGCACCCAAGCCCGTGGGGA
C
CTCTTTGACCTGGCCGTGCCCATGCCTGAGGTGCTGTATGAAGAGGTGCTGGAGGTGGACGAACGCGTG
GTG
CTGCACCGTGGAGAGGCGGGCACCGGGACGCCTGTGAAAGGCCGCACGGGGGACCTGCTGGAAGTGC
AG
CAGCCTGTGGACCTGGGGGCCCTGCGTGGGAAGCTGGAGGGGCTGCTATCTCGAGGCATCCGCAGCCT
G
GCTGTGGTGCTCATGCACTCGTACACGTGGGCCCAGCATGAGCAGCAGGTGGGTGTGCTGGCCCGGGAG
CTG
GGCTTCACGCACGTGTCACTGTCCTCGGAGGCCATGCCCATGGTGCGCATCGTCCCTCGGGGGCACA
CG
GCCTGTGCCGACGCCTACCTCACGCCCGCCATCCAGCGCTACGTGCAGGGCTTCTGCCGTGGCTTCCA
G
GGCCAACTCAAGGATGTGCAGGTGTTGTTCATGCGCTCCGATGGCGGCCTGGCGCCCATGGACACCTTC
AGC
GGCTCCAGTGCTGTGCTCTCGGGCCCGGCCGGCGGCGTGGTGGGCTACTCAGCCACCACCTACCAGC
AG
GAGGGTGGCCAGCCTGTCATCGGCTTTGACATGGGAGGCACGTCCACGGATGTGAGCCGCTATGCTGG
G
GAATTCGAGCACGTCTTCGAGGCCAGCACAGCTGGCGTCACCCTCCAGGCCCCGCAGCTGGACATCAAC
ACC
GTGGCAGCGGGAGGGGGTTCCCGCCTCTTCTTCAGGTCTGGCCTCTTTGTGGTTGGGCCCGAGTCAG
CA
GGAGCCCACCCAGGACCCGCCTGCTACCGCAAAGGGGGCCCTGTGACAGTGACGGATGCTAATCTGGT
C
CTGGGTCGCCTGCTGCCTGCCTCCTTCCCCTGCATTTTTGGGCCGGGAGAGAACCAACCACTTTCCCCT
GAG
GCCTCCCGCAAAGCCCTGGAGGCTGTGGCCACTGAGGTCAACAGCTTCCTGACCAACGGGCCCTGCC
CG
GCCTCCCCGCTGAGCCTGGAGGAGGTGGCCATGGGGTTCGTGCGCGTGGCCAACGAGGCCATGTGCCG
G
CCCATCCGTGCACTCACGCAGGCAAGAGGCCATGACCCCTCAGCCCATGTGCTGGCCTGCTTTGGGGGA
GCT
GGTGGGCAGCATGCATGTGCCATCGCCCGGGCCCTGGGCATGGACACGGTGCACATCCACAGGCACA
GT
GGGCTGCTGTCGGCCCTGGGGCTGGCCCTGGCTGACGTGGTGCATGAGGCACAGGAACCCTGCTCCCT
G
CTCTACGCGCCTGAGACCTTCGTGCAGCTGGACCAGAGGCTGAGCCGCCTGGAGGAGCAGTGTGTGGAT
GCT
CTGCAGGCCCAGGGCTTCCCCAGGTCCCAGATCAGCACTGAGAGCTTCCTGCACCTGCGCTACCAGG
GC
ACGGACTGTGCTCTGATGGTGTCTGCCCACCAGCACCCAGCCACAGCCCGCTCGCCCCGTGCGGGGGA
C
TTCGGGGCAGCCTTTGTGGAGCGGTACATGAGGGAGTTTGGCTTTGTCATACCTGAGCGGCCGGTGGTC
GTG
GACGATGTGCGAGTGCGGGGCACCGGCCGCAGTGGTCTTCGCCTCGAGGATGCCCCCAAAGCCCAGA
CC
GGGCCTCCCCGGGTGGACAAGATGACCCAGTGCTACTTTGAGGGGGGCTACCAGGAGACCCCTGTGTA
C
CTGCTGGCAGAGCTGGGCTATGGGCACAAGCTCCATGGGCCCTGCCTCATCATCGACAGTAACAGCACC
ATC
CTGGTGGAGCCAGGTTGCCAGGCAGAGGTGACCAAGACAGGGGACATCTGCATCTCCGTGGGGGCCG
AA
GTCCCCGGCACAGTGGGCCCCCAGCTGGACCCTATCCAGCTGTCCATCTTCTCACACCGCTTCATGAG
C
ATTGCTGAGCAGATGGGCCGCATCCTGCAGCGCACAGCCATCTCCACCAACATCAAGGAGCGTCTGGAC
TTC
TCCTGTGCCCTCTTTGGGCCCGATGGGGGGCTGGTGTCCAATGCCCCCCACATCCCTGTGCACCTGG
GT
GCCATGCAGGAGACGGTGCAGTTCCAGATTCAGCACCTGGGGGCCGATCTCCACCCTGGCGACGTGCT
A
CTGAGCAACCATCCCAGTGCCGGGGGCAGCCACCTGCCAGACCTGACTGTTATCACACCGGTGTTTTGG
CCG
GGTCAGACGCGGCCTGTGTTCTATGTGGCCAGCCGAGGGCACCACGCAGACATCGGGGGCATCACAC
CA
GGCTCCATGCCCCCCCACTCCACCATGCTGCAACAGGAGGGTGCCGTCTTTCTGTCCTTCAAACTTGT
C
CAGGGGGGCGTCTTCCAGGAGGAGGCGGTGACGGAGGCCCTGCGGGCGCCAGGCAAGGTCCCCAACTGC
AGC
GGAACCAGAAACCTGCACGACAACCTGTCGGACCTCCGTGCCCAGGTGGCAGCCAACCAGAAGGGCA
TC
CAGCTGGTGGGGGAGCTCATTGGGCAGTACGGCCTGGACGTGGTGCAGGCCTACATGGGCCATATTCA
G
GCAAACGCTGAGCTGGCCGTGCGAGACATGTTGCGTGCCTTTGGAACCTCCCGGCAGGCCCGGGGCCTG
CCC
CTGGAGGTGTCCTCGGAAGACCACATGGACGACGGTTCCCCCATCCGCCTCCGTGTGCAGATCAGCC
TG
AGTCAGGGCAGCGCCGTGTTTGACTTCAGCGGCACTGGGCCGGAGGTGTTTGGTAATCTCAACGCACC
G
CGGGCCGTAACCCTGTCCGCCCTCATCTACTGCCTGCGCTGTCTGGTGGGCCGCGACATCCCACTCAAC
CAG
GGCTGCCTGGCGCCAGTGCGCGTGGTCATTCCCCGAGGCTCCATCCTGGACCCGTCGCCCGAGGCGG
CG
GTGGTGGGCGGCAACGTGCTCACGTCGCAGCGCGTGGTGGATGTCATCCTGGGGGCCTTTGGGGCCTG
C
GCCGCCTCCCAGGGCTGCATGAACAACGTGACCCTGGGCAACGCCCACATGGGCTACTACGAGACGGTG
GCG
GGCGGCGCGGGCGCGGGTCCCAGCTGGCACGGGCGCAGCGGTGTGCACAGCCACATGACCAACACAC
GC
ATCACCGACCCTGAGATCCTGGAGAGCCGGTACCCGGTCATCCTGCGCCGCTTCGAGCTGCGGCGGGG
C
TCGGGGGGCAGAGGCCGCTTCCGAGGCGGCGACGGCGTCACCCGCGAGCTGCTCTTTCGTGAGGAGGCG
CTG
CTGTCAGTGCTGACCGAGCGCCGCGCCTTCCGGCCATACGGGCTCCACGGGGGCGAGCCTGGCGCCC
GC
GGCCTAAACCTGCTGATCCGCAAAAACGGCCGGACGGTGAATCTGGGCGGCAAGACGTCGGTGACCGT
G
TACCCCGGGGATGTGTTCTGTCTCCACACGCCCGGCGGCGGTGGCTATGGGGACCCGGAGGACCCCGCC
CCA
CCGCCGGGGTCGCCCCCGCAAGCACTGGCCTTTCCCGAGCACGGCAGCGTCTATGAGTATCGCCGGG
CC
CAGGAGGCCGTGTGA


Translation (1288 aa):
MGSPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGIRRILEQEAGMLLPRDQPLD
S
SHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIGTQARGDLFDL
AVPMPEVLYEEVLEVDERV
V
LHRGEAGTGTPVK
GRTGDLLEVQQPVDLGALRGKLEGLLSRGIRSLAVVLMHSYTWAQHEQQVGVLARE
L
GFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLK
DVQVLFMRSDGGLAPMDTF
S
GSSAVLSGPAGGVVGYSATTYQQEGGQPVIGFDMG
GTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDIN
T
VAAGGGSRLFF
RSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGENQPLSP
E
ASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRALTQ
ARGHDPSAHVLACFGG
A
GGQHACAIARALGMDTVHIH
RHSGLLSALGLALADVVHEAQEPCSLLYAPETFVQLDQRLSRLEEQCVD
A
LQAQGFP
RSQISTESFLHLRYQGTDCALMVSAHQHPATARSPRAGDFGAAFVERYMREFGFVIPERPVV
V
DDVRVRGTGRSGLRLEDAPKAQTGPPRVDK
MTQCYFEGGYQETPVYLLAELGYGHKLHGPCLIIDSNST
I
LVEPGCQAEVTKTGDICISVGAEVPGTVGPQLDPIQLSIFSHRFMSIA
EQMGRILQRTAISTNIKERLD
F
SCALFGPDGGLVSNAPHIPVHLGAMQETVQFQ
IQHLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
P
GQTRPVFYVASRGHHADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGVFQEE
AVTEALRAPGKVPNC
S
GTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQ
ANAELAVRDMLRAFGTSRQARGL
P
LEVSSEDHMDDGSPIRLRVQISLSQ
GSAVFDFSGTGPEVFGNLNAPRAVTLSALIYCLRCLVGRDIPLN
Q
GCLAPVRVVIPRGSILDPSPEAAVVGGNVLTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETV
A
GGAGAGPSWHGRSGVHSHMTNTRITDPEILES
RYPVILRRFELRRGSGGRGRFRGGDGVTRELLFREEA
L
LSVLTERRAFRPYGLH
GGEPGARGLNLLIRKNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPEDPA
P
PPGSPPQALAFPEHGSVYEYRRAQEAV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser