NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS68157.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
68157.1 Public Homo sapiens 20 NFATC2 22 109 92 CCDS HistoryNCBI Gene:4773Re-query CCDS DB by CCDS ID:68157.1Re-query CCDS DB by GeneID:4773See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 15, NCBI annotation release 105, Ensembl annotation release 74

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 68157.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000609943.5 ENSP00000477370.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000609943.5Link to Ensembl Protein Viewer:ENSP00000477370.1Re-query CCDS DB by Nucleotide ID:ENST00000609943Re-query CCDS DB by Protein ID:ENSP00000477370
Original member NCBI NM_001258292.1 NP_001245221.1 Updated not alive Link to Nucleotide Sequence:NM_001258292.1Link to Protein Sequence:NP_001245221.1Re-query CCDS DB by Nucleotide ID:NM_001258292Re-query CCDS DB by Protein ID:NP_001245221
Current member NCBI NM_001258292.2 NP_001245221.1 Accepted alive Link to Nucleotide Sequence:NM_001258292.2Link to Protein Sequence:NP_001245221.1Re-query CCDS DB by Nucleotide ID:NM_001258292Re-query CCDS DB by Protein ID:NP_001245221Link to BLAST:NP_001245221.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001245221.1 905 Q13469-4 905 100% 0 0

Chromosomal Locations for CCDS 68157.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 51391396 51391451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51432067 51432756 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51435188 51435314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51435706 51435761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51454548 51454688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51473980 51474152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51475458 51475660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51516784 51516955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51523081 51524110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 51562560 51562629 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2718 nt):
ATGCAGAGAGAGGCTGCGTTCAGACTGGGGCACTGCCATCCCCTCCGCATCATGGGGTCTGTGGACCAAG
AA
GAGCCGAATGCACATAAGGTCGCCAGCCCACCCTCCGGACCCGCATACCCCGATGATGTCCTGGACTA
T
GGCCTCAAGCCATACAGCCCCCTTGCTAGTCTCTCTGGCGAGCCCCCCGGCCGATTCGGAGAGCCGGAT
AGG
GTAGGGCCGCAGAAGTTTCTGAGCGCGGCCAAGCCAGCAGGGGCCTCGGGCCTGAGCCCTCGGATCG
AG
ATCACTCCGTCCCACGAACTGATCCAGGCAGTGGGGCCCCTCCGCATGAGAGACGCGGGCCTCCTGGT
G
GAGCAGCCGCCCCTGGCCGGGGTGGCCGCCAGCCCGAGGTTCACCCTGCCCGTGCCCGGCTTCGAGGGC
TAC
CGCGAGCCGCTTTGCTTGAGCCCCGCTAGCAGCGGCTCCTCTGCCAGCTTCATTTCTGACACCTTCT
CC
CCCTACACCTCGCCCTGCGTCTCGCCCAATAACGGCGGGCCCGACGACCTGTGTCCGCAGTTTCAAAA
C
ATCCCTGCTCATTATTCCCCCAGAACCTCGCCAATAATGTCACCTCGAACCAGCCTCGCCGAGGACAGC
TGC
CTGGGCCGCCACTCGCCCGTGCCCCGTCCGGCCTCCCGCTCCTCATCGCCTGGTGCCAAGCGGAGGC
AT
TCGTGCGCCGAGGCCTTGGTTGCCCTGCCGCCCGGAGCCTCACCCCAGCGCTCCCGGAGCCCCTCGCC
G
CAGCCCTCATCTCACGTGGCACCCCAGGACCACGGCTCCCCGGCTGGGTACCCCCCTGTGGCTGGCTCT
GCC
GTGATCATGGATGCCCTGAACAGCCTCGCCACGGACTCGCCTTGTGGGATCCCCCCCAAGATGTGGA
AG
ACCAGCCCTGACCCCTCGCCGGTGTCTGCCGCCCCATCCAAGGCCGGCCTGCCTCGCCACATCTACCC
G
GCCGTGGAGTTCCTGGGGCCCTGCGAGCAGGGCGAGAGGAGAAACTCGGCTCCAGAATCCATCCTGCTG
GTT
CCGCCCACTTGGCCCAAGCCGCTGGTGCCTGCCATTCCCATCTGCAGCATCCCAGTGACTGCATCCC
TC
CCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAA
G
CCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCAC
CCT
GTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTG
AT
GAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCAC
C
AGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGG
GCA
ACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGG
AC
ATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAAT
C
GTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTT
GAA
AGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTA
CA
TCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCAC
G
GTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATC
CGC
ACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTA
CC
TACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCC
C
ACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGC
CTC
GTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGC
AA
CAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCA
G
CCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCC
CAG
GGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACT
CA
CCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTT
C
GCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTAC
CCC
ACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACC
AA
AAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGA
T
GTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAA


Translation (905 aa):
MQREAAFRLGHCHPLRIMGSVDQEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPD
R
VGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEG
Y
REPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDS
C
LGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS
A
VIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILL
V
PPTWPKPLVPAIPIC
SIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGH
P
VVQ
LHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMR
A
TIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMV
E
RQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTT
DGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHI
R
TPVKVNFYVINGKRKRSQPQHFTYHP
VPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC
L
VATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGS
Q
GQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSY
P
TVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDD
VNEIIRKEFSGPPARNQT



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser