NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6673.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6673.1 Public Homo sapiens 9 NAA35 22 109 92 CCDS HistoryNCBI Gene:60560Re-query CCDS DB by CCDS ID:6673.1Re-query CCDS DB by GeneID:60560See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 6673.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000361671.9 ENSP00000354972.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000361671.9Link to Ensembl Protein Viewer:ENSP00000354972.5Re-query CCDS DB by Nucleotide ID:ENST00000361671Re-query CCDS DB by Protein ID:ENSP00000354972
Original member Current member NCBI NM_001321881.1 NP_001308810.1 Accepted alive Link to Nucleotide Sequence:NM_001321881.1Link to Protein Sequence:NP_001308810.1Re-query CCDS DB by Nucleotide ID:NM_001321881Re-query CCDS DB by Protein ID:NP_001308810Link to BLAST:NP_001308810.1
Original member Current member NCBI NM_001321882.1 NP_001308811.1 Accepted alive Link to Nucleotide Sequence:NM_001321882.1Link to Protein Sequence:NP_001308811.1Re-query CCDS DB by Nucleotide ID:NM_001321882Re-query CCDS DB by Protein ID:NP_001308811Link to BLAST:NP_001308811.1
Original member NCBI NM_024635.3 NP_078911.3 Updated not alive Link to Nucleotide Sequence:NM_024635.3Link to Protein Sequence:NP_078911.3Re-query CCDS DB by Nucleotide ID:NM_024635Re-query CCDS DB by Protein ID:NP_078911
Current member NCBI NM_024635.4 NP_078911.3 Accepted alive Link to Nucleotide Sequence:NM_024635.4Link to Protein Sequence:NP_078911.3Re-query CCDS DB by Nucleotide ID:NM_024635Re-query CCDS DB by Protein ID:NP_078911Link to BLAST:NP_078911.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001308810.1 725 Q5VZE5-1 725 100% 0 0
NP_001308811.1 725 Q5VZE5-1 725 100% 0 0
NP_078911.3 725 Q5VZE5-1 725 100% 0 0

Chromosomal Locations for CCDS 6673.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 85942160 85942283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85956360 85956393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85958472 85958586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85959793 85959867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85962013 85962180 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85974967 85975033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85975114 85975157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85976685 85976735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85977363 85977446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85978267 85978381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 85996399 85996577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86003585 86003644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86007358 86007464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86009865 86009931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86013046 86013144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86013719 86013897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86016539 86016675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86017498 86017565 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86018255 86018395 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86018699 86018821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86020889 86020969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 86021901 86021960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2178 nt):
ATGGTTATGAAAGCTTCTGTAGATGATGACGATTCAGGATGGGAGCTCAGTATGCCAGAAAAAATGGAGA
AA
AGCAATACAAACTGGGTGGACATTACCCAAGATTTTGAAGAAGCTTGTCGAGAATTAAAGTTGGGAGA
A
CTACTTCATGATAAGCTATTTGGTCTTTTTGAAGCCATGTCTGCTATTGAAATGATGGATCCCAAGATG
GAT
GCTGGCATGATTGGAAACCAAGTTAATCGAAAAGTTCTCAATTTTGAACAAGCTATCAAGGATGGCA
CT
ATTAAAATTAAAGATCTCACCTTGCCTGAACTGATAGGGATTATGGATACATGTTTTTGCTGTTTGAT
A
ACGTGGTTAGAAGGCCATTCACTGGCACAGACAGTATTTACGTGCCTTTACATTCATAATCCAGACTTT
ATA
GAAGATCCTGCTATGAAGGCTTTTGCTCTGGGAATCTTGAAAATCTGTGACATTGCAAGGGAAAAAG
TA
AATAAAGCTGCTGTTTTTGAAGAGGAAGATTTTCAGTCAATGACTTATGGATTTAAAATGGCTAACAG
T
GTGACAGATCTTCGAGTTACAGGCATGCTAAAAGATGTGGAGGATGACATGCAAAGAAGAGTAAAGAGT
ACT
CGAAGTCGACAAGGAGAAGAAAGAGATCCAGAAGTTGAACTAGAACACCAACAATGTTTAGCAGTAT
TC
AGCAGAGTGAAATTTACTCGTGTGTTACTGACAGTGCTTATAGCCTTTACTAAGAAAGAGACCAGTGC
T
GTTGCAGAAGCTCAAAAATTGATGGTTCAAGCAGCAGATCTTCTTTCTGCCATTCATAATTCATTGCAT
CAT
GGCATCCAGGCCCAGAATGATACTACAAAAGGAGATCATCCAATTATGATGGGTTTTGAACCCCTTG
TG
AACCAGAGGCTACTTCCACCTACCTTCCCTCGATATGCAAAAATAATTAAAAGGGAAGAAATGGTGAA
C
TATTTTGCAAGATTAATAGATAGAATAAAAACTGTCTGTGAGGTTGTGAATTTAACAAATTTACATTGT
ATC
CTGGATTTTTTCTGTGAATTTAGTGAACAGTCACCATGTGTTCTTTCAAGATCTCTGTTACAAACCA
CT
TTCCTGGTGGATAACAAAAAGGTCTTTGGAACTCATCTCATGCAAGACATGGTGAAAGATGCACTTCG
G
TCTTTTGTCAGTCCTCCGGTGCTTTCCCCCAAGTGCTACCTATATAATAATCACCAGGCTAAGGACTGT
ATC
GACTCCTTTGTTACTCACTGTGTTCGGCCATTCTGTAGTCTTATTCAGATCCATGGACATAACAGGG
CT
CGACAGAGAGATAAGCTTGGTCATATTCTTGAGGAATTTGCCACCTTGCAGGATGAGGCAGAGAAGGT
T
GATGCAGCGCTTCACACCATGCTGTTGAAACAGGAACCCCAAAGGCAACATTTGGCCTGTTTAGGTACC
TGG
GTCCTTTACCATAACCTTCGCATTATGATACAGTACCTTCTAAGTGGCTTTGAATTGGAACTCTACA
GT
ATGCACGAGTACTATTACATATATTGGTATCTCTCTGAATTCCTTTACGCATGGTTGATGTCAACATT
G
AGTCGTGCCGATGGCTCTCAAATGGCAGAGGAAAGGATAATGGAAGAGCAGCAGAAAGGCCGTAGTAGT
AAA
AAAACAAAGAAAAAAAAGAAAGTTCGCCCATTGAGCCGAGAGATCACAATGAGCCAAGCATATCAGA
AC
ATGTGTGCTGGAATGTTTAAAACCATGGTAGCATTTGACATGGACGGCAAAGTACGTAAACCGAAGTT
T
GAGCTTGATAGTGAACAAGTTCGGTATGAACACAGGTTTGCTCCATTCAACAGTGTGATGACCCCGCCG
CCA
GTGCACTACTTACAGTTCAAGGAAATGTCTGACCTCAATAAATATAGCCCTCCTCCTCAGTCTCCTG
AA
CTGTATGTGGCAGCTAGTAAGCACTTTCAACAGGCAAAAATGATATTGGAAAATATTCCTAACCCGGA
C
CATGAGGTTAATAGAATTTTAAAGGTTGCCAAACCCAACTTTGTGGTTATGAAGTTATTGGCAGGAGGA
CAC
AAAAAGGAATCTAAAGTTCCTCCTGAATTTGATTTCTCTGCTCATAAATATTTTCCTGTTGTGAAAC
TT
GTTTGA


Translation (725 aa):
MVMKASVDDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKM
D
AGMIGNQVNRKVLNFEQAIK
DGTIKIKDLTLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDF
I
EDPAMKAFALGILKICDIAREKVNKAAVFEE
EDFQSMTYGFKMANSVTDLRVTGMLKDVEDDMQRRVKS
T
RSRQGEERDPEVELE
HQQCLAVFSRVKFTRVLLTVLIAFTKKETSAVAEAQKLMVQAADLLSAIHNSLH
H
GIQAQNDTTKG
DHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFARLIDRIKTVCEVVNLTNLHC
I
L
DFFCEFSEQSPCVLSRSLLQTTFLVDNKKVFGTHLMQDMVKDALRSFVSPPVLSPKCYLYNNHQAKDC
I
DSFVTHCVR
PFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHTMLLKQEPQRQHLACLGT
W
VLYHNLRIMIQYLLSGFELELYSMHEYYYIY
WYLSEFLYAWLMSTLSRADGSQMAEERIMEEQQKGRSS
K
KTKKKKK
VRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKFELDSEQVRYEHRFAPFNSVMTPP
P
VHYLQFK
EMSDLNKYSPPPQSPELYVAASKHFQQAKMILENIPNPDHEVNRILKVAKPNFVVMKLLAGG
H
KKESK
VPPEFDFSAHKYFPVVKLV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser