NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6600.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6600.1 Public Homo sapiens 9 CLTA 22 109 92 CCDS HistoryNCBI Gene:1211Re-query CCDS DB by CCDS ID:6600.1Re-query CCDS DB by GeneID:1211See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6600.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000345519.9 ENSP00000242284.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000345519.9Link to Ensembl Protein Viewer:ENSP00000242284.6Re-query CCDS DB by Nucleotide ID:ENST00000345519Re-query CCDS DB by Protein ID:ENSP00000242284
Original member NCBI NM_001833.3 NP_001824.1 Updated not alive Link to Nucleotide Sequence:NM_001833.3Link to Protein Sequence:NP_001824.1Re-query CCDS DB by Nucleotide ID:NM_001833Re-query CCDS DB by Protein ID:NP_001824
Current member NCBI NM_001833.4 NP_001824.1 Accepted alive Link to Nucleotide Sequence:NM_001833.4Link to Protein Sequence:NP_001824.1Re-query CCDS DB by Nucleotide ID:NM_001833Re-query CCDS DB by Protein ID:NP_001824Link to BLAST:NP_001824.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001824.1 218 P09496-2 218 100% 0 0

Chromosomal Locations for CCDS 6600.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 36191057 36191273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 36197551 36197588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 36198979 36199096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 36204068 36204179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 36211603 36211774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (657 nt):
ATGGCTGAGCTGGATCCGTTCGGCGCCCCTGCCGGCGCCCCTGGCGGTCCCGCGCTGGGGAACGGAGTGG
CC
GGCGCCGGCGAAGAAGACCCGGCTGCGGCCTTCTTGGCGCAGCAAGAGAGCGAGATTGCGGGCATCGA
G
AACGACGAGGCCTTCGCCATCCTGGACGGCGGCGCCCCCGGGCCCCAGCCGCACGGCGAGCCGCCGGGG
GGT
CCGGATGCTGTTGATGGAGTAATGAATGGTGAATACTACCAGGAAAGTAATGGTCCAACAGACAGTT
AT
GCAGCTATTTCACAAGTGGATCGATTGCAGTCAGAGCCTGAAAGTATCCGTAAATGGAGAGAAGAACA
A
ATGGAACGCTTGGAAGCCCTTGATGCCAATTCTCGGAAGCAAGAAGCAGAGTGGAAAGAAAAGGCAATA
AAG
GAGCTAGAAGAATGGTATGCAAGACAGGACGAGCAGCTACAGAAAACAAAAGCAAACAACAGGGCAG
CA
GAAGAAGCCTTTGTAAATGACATTGACGAGTCGTCCCCAGGCACTGAGTGGGAACGGGTGGCCCGGCT
G
TGTGACTTTAACCCCAAGTCTAGCAAGCAGGCCAAAGATGTCTCCCGCATGCGCTCAGTCCTCATCTCC
CTC
AAGCAGGCCCCGCTGGTGCACTGA


Translation (218 aa):
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPG
G
P
DAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAI
K
ELEEWYARQDEQLQKTKANN
RAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
L
KQAPLVH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser