NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6425.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6425.1 Public Homo sapiens 8 VPS28 22 109 92 CCDS HistoryNCBI Gene:51160Re-query CCDS DB by CCDS ID:6425.1Re-query CCDS DB by GeneID:51160See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6425.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000292510.5 ENSP00000292510.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000292510.5Link to Ensembl Protein Viewer:ENSP00000292510.3Re-query CCDS DB by Nucleotide ID:ENST00000292510Re-query CCDS DB by Protein ID:ENSP00000292510
Original member Current member EBI,WTSI ENST00000526054.5 ENSP00000434064.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000526054.5Link to Ensembl Protein Viewer:ENSP00000434064.1Re-query CCDS DB by Nucleotide ID:ENST00000526054Re-query CCDS DB by Protein ID:ENSP00000434064
Original member Current member NCBI NM_016208.3 NP_057292.1 Accepted alive Link to Nucleotide Sequence:NM_016208.3Link to Protein Sequence:NP_057292.1Re-query CCDS DB by Nucleotide ID:NM_016208Re-query CCDS DB by Protein ID:NP_057292Link to BLAST:NP_057292.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057292.1 221 Q9UK41-1 221 100% 0 0

Chromosomal Locations for CCDS 6425.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 144423805 144423922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144424041 144424132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144424215 144424268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144424718 144424819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144424946 144425051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144425683 144425772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144426026 144426063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144426180 144426208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 144426909 144426945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (666 nt):
ATGTTTCATGGGATCCCAGCCACGCCGGGCATAGGAGCCCCTGGGAACAAGCCGGAGCTGTATGAGGAAG
TG
AAGTTGTACAAGAACGCCCGGGAGAGGGAGAAGTACGACAACATGGCAGAGCTGTTTGCGGTGGTGAA
G
ACAATGCAAGCCCTGGAGAAGGCCTACATCAAGGACTGTGTCTCCCCCAGCGAGTACACTGCAGCCTGC
TCC
CGGCTCCTGGTCCAATACAAAGCTGCCTTCAGGCAGGTCCAGGGCTCAGAAATCAGCTCTATTGACG
AA
TTCTGCCGCAAGTTCCGCCTGGACTGCCCGCTGGCCATGGAGCGGATCAAGGAGGACCGGCCCATCAC
C
ATCAAGGACGACAAGGGCAACCTCAACCGCTGCATCGCAGACGTGGTCTCGCTCTTCATCACGGTCATG
GAC
AAGCTGCGTCTGGAGATCCGCGCCATGGATGAGATCCAGCCCGACCTGCGAGAGCTGATGGAGACCA
TG
CACCGCATGAGCCACCTCCCACCCGACTTTGAGGGCCGCCAGACGGTCAGCCAGTGGCTGCAGACCCT
G
AGCGGCATGTCGGCGTCAGATGAGCTGGACGACTCACAGGTGCGTCAGATGCTGTTCGACCTGGAGTCA
GCC
TACAACGCCTTCAACCGCTTCCTGCATGCCTGA


Translation (221 aa):
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC
S
RLLVQYKAAFRQVQGSEISSIDEFCRKFR
LDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM
D
KLRLEIRAMDE
IQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLES
A
YNAFNRFLHA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser