NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS63094.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
63094.1 Public Homo sapiens 2 ABI2 22 109 92 CCDS HistoryNCBI Gene:10152Re-query CCDS DB by CCDS ID:63094.1Re-query CCDS DB by GeneID:10152See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 14, NCBI annotation release 105, Ensembl annotation release 73

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 63094.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000424558.5 ENSP00000391433.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000424558.5Link to Ensembl Protein Viewer:ENSP00000391433.1Re-query CCDS DB by Nucleotide ID:ENST00000424558Re-query CCDS DB by Protein ID:ENSP00000391433
Original member NCBI NM_001282926.1 NP_001269855.1 Updated not alive Link to Nucleotide Sequence:NM_001282926.1Link to Protein Sequence:NP_001269855.1Re-query CCDS DB by Nucleotide ID:NM_001282926Re-query CCDS DB by Protein ID:NP_001269855
Current member NCBI NM_001282926.2 NP_001269855.1 Accepted alive Link to Nucleotide Sequence:NM_001282926.2Link to Protein Sequence:NP_001269855.1Re-query CCDS DB by Nucleotide ID:NM_001282926Re-query CCDS DB by Protein ID:NP_001269855Link to BLAST:NP_001269855.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001269855.1 507 Q9NYB9-4 507 99.4083% 0 3

Chromosomal Locations for CCDS 63094.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 203328515 203328631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 203366877 203367044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 203380208 203380384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 203391046 203391143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 203394700 203394846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 203395656 203395780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 203396785 203396967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 203402576 203402734 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 203416908 203417081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 203427177 203427352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1524 nt):
ATGGCGGAGCTGCAGATGCTGCTGGAAGAGGAAATCCCGGGGGGCCGCCGGGCCCTCTTCGACAGCTACA
CA
AATCTGGAACGGGTGGCCGATTACTGCGAGAACAACTACATACAGTCAGCAGATAAGCAGAGAGCCCT
A
GAAGAAACCAAAGCCTACACCACCCAATCCTTAGCAAGTGTTGCCTATCTGATAAACACCTTGGCCAAC
AAT
GTCCTGCAGATGCTGGATATCCAGGCATCCCAGCTACGAAGGATGGAATCTTCAATCAATCATATTT
CA
CAAACAGTTGATATTCATAAAGAGAAAGTTGCAAGAAGAGAAATTGGTATTTTGACTACCAATAAAAA
C
ACTTCAAGGACACATAAGATTATTGCTCCAGCCAACCTTGAACGACCAGTTCGTTATATTAGAAAACCT
ATT
GACTATACAATTCTAGATGATATTGGACATGGAGTAAAGGTGAGTACCCAGAACATGAAGATGGGTG
GG
CTGCCGCGTACAACACCTCCAACTCAGAAGCCCCCTAGTCCCCCTATGTCAGGGAAAGGGACACTTGG
G
CGGCACTCCCCCTATCGCACACTGGAGCCAGTGCGTCCTCCAGTGGTACCAAATGATTACGTACCTAGC
CCA
ACCCGTAATATGGCTCCCTCGCAGCAGAGCCCTGTGAGGACAGCTTCTGTGAATCAAAGAAATCGAA
CT
TACAGCAGCAGTGGGAGTAGTGGAGGGAGCCACCCAAGTAGTCGGAGCAGCAGTCGAGAGAACAGTGG
A
AGTGGTAGTGTGGGGGTTCCTATTGCTGTTCCTACTCCATCTCCTCCCAGTGTCTTTCCAGCCCCTGCT
GGC
TCTGCTGGCACTCCTCCCCTTCCTGCTACTTCTGCATCTGCCCCTGCTCCTCTTGTTCCTGCTACTG
TC
CCTTCCTCCACTGCCCCAGACGCTGCTGCTGGGGGTGCCCAGACCCTTGCTGATGGCTTCACTTCTCC
A
ACTCCCCCTGTTGTTTCTTCCACTCCCCCTACAGGTCATCCTGTACAGTTCTACAGCATGAATAGGCCT
GCC
TCTCGCCATACTCCCCCAACAATAGGGGGCTCGTTGCCCTATAGACGCCCTCCTTCCATTACTTCAC
AA
ACAAGCCTTCAGAATCAGATGAATGGAGGACCTTTTTATAGCCAGAATCCAGTTTCAGATACACCACC
T
CCACCGCCACCTGTGGAAGAACCAGTCTTTGATGAGTCTCCCCCACCTCCTCCTCCTCCAGAAGATTAC
GAA
GAGGAGGAAGCTGCTGTGGTTGAGTATAGTGATCCTTATGCTGAAGAGGACCCACCGTGGGCTCCAC
GT
TCTTACTTGGAAAAGGTTGTGGCAATTTATGACTATACAAAAGACAAGGAAGATGAGCTGTCCTTTCA
G
GAAGGAGCCATTATTTATGTCATCAAGAAGAATGACGATGGTTGGTATGAGGGAGTTATGAATGGAGTG
ACT
GGGCTTTTTCCTGGGAATTACGTTGAGTCTATCATGCATTATTCTGAGTAA


Translation (507 aa):
MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLAN
N
VLQMLDIQASQLRRMESSINHISQ
TVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKP
I
DYTILDDIGHGVK
VSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPS
P
TRNMAPSQQSPVRTASVNQRNRTY
SSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPA
G
SAGTPPLPATSASAPAPLVPATVPSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPT
GHPVQFYSMNRP
A
SRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNP
VSDTPPPPPPVEEPVFDESPPPPPPPEDY
E
EEEAAVVEYSDPYAEEDPPWAPRSYLEK
VVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGV
T
GLFPGNYVESIMHYSE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser