NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS61189.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
61189.1 Public Homo sapiens 12 MDM2 22 109 92 CCDS HistoryNCBI Gene:4193Re-query CCDS DB by CCDS ID:61189.1Re-query CCDS DB by GeneID:4193See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 14, NCBI annotation release 105, Ensembl annotation release 73

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 61189.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000299252.8 ENSP00000299252.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000299252.8Link to Ensembl Protein Viewer:ENSP00000299252.4Re-query CCDS DB by Nucleotide ID:ENST00000299252Re-query CCDS DB by Protein ID:ENSP00000299252
Original member NCBI NM_001278462.1 NP_001265391.1 Updated not alive Link to Nucleotide Sequence:NM_001278462.1Link to Protein Sequence:NP_001265391.1Re-query CCDS DB by Nucleotide ID:NM_001278462Re-query CCDS DB by Protein ID:NP_001265391
Current member NCBI NM_001278462.2 NP_001265391.1 Accepted alive Link to Nucleotide Sequence:NM_001278462.2Link to Protein Sequence:NP_001265391.1Re-query CCDS DB by Nucleotide ID:NM_001278462Re-query CCDS DB by Protein ID:NP_001265391Link to BLAST:NP_001265391.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001265391.1 321 Q00987-5 321 100% 0 0

Chromosomal Locations for CCDS 61189.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 68809212 68809292 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 68813554 68813628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 68835829 68835984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 68836672 68836749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 68839274 68839849 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (966 nt):
ATGTGCAATACCAACATGTCTGTACCTACTGATGGTGCTGTAACCACCTCACAGATTCCAGCTTCGGAAC
AA
GAGACCCTGGTTAGACCAAAGCCATTGCTTTTGAAGTTATTAAAGTCTGTTGGTGCACAAAAAGACAC
T
TATACTATGAAAGAGGATCTTGATGCTGGTGTAAGTGAACATTCAGGTGATTGGTTGGATCAGGATTCA
GTT
TCAGATCAGTTTAGTGTAGAATTTGAAGTTGAATCTCTCGACTCAGAAGATTATAGCCTTAGTGAAG
AA
GGACAAGAACTCTCAGATGAAGATGATGAGGTATATCAAGTTACTGTGTATCAGGCAGGGGAGAGTGA
T
ACAGATTCATTTGAAGAAGATCCTGAAATTTCCTTAGCTGACTATTGGAAATGCACTTCATGCAATGAA
ATG
AATCCCCCCCTTCCATCACATTGCAACAGATGTTGGGCCCTTCGTGAGAATTGGCTTCCTGAAGATA
AA
GGGAAAGATAAAGGGGAAATCTCTGAGAAAGCCAAACTGGAAAACTCAACACAAGCTGAAGAGGGCTT
T
GATGTTCCTGATTGTAAAAAAACTATAGTGAATGATTCCAGAGAGTCATGTGTTGAGGAAAATGATGAT
AAA
ATTACACAAGCTTCACAATCACAAGAAAGTGAAGACTATTCTCAGCCATCAACTTCTAGTAGCATTA
TT
TATAGCAGCCAAGAAGATGTGAAAGAGTTTGAAAGGGAAGAAACCCAAGACAAAGAAGAGAGTGTGGA
A
TCTAGTTTGCCCCTTAATGCCATTGAACCTTGTGTGATTTGTCAAGGTCGACCTAAAAATGGTTGCATT
GTC
CATGGCAAAACAGGACATCTTATGGCCTGCTTTACATGTGCAAAGAAGCTAAAGAAAAGGAATAAGC
CC
TGCCCAGTATGTAGACAACCAATTCAAATGATTGTGCTAACTTATTTCCCCTAG


Translation (321 aa):
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEDLDAGVSEHSGDWLDQDS
V
SDQFSVEFEVESLDSEDYSLSEEGQELSDEDDE
VYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNE
M
NPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDD
K
ITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCI
V
HGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser